Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IFT122 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Intraflagellar transport 122 homolog (Chlamydomonas)

Gene Aliases

CED, SPG, CED1, FAP80, WDR10, WDR10p, WDR140

Gene ID

55764

Swiss Prot

Q9HBG6

Accession Number

NP_443716

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human IFT122

Target

IFT122 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. IFT122 contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This cytoplasmic protein contains seven WD repeats and an AF-2 domain which function by recruiting coregulatory molecules and in transcriptional activation. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Partner Proteins

UBC; gag-pol

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

QADPAQKDTMLGKFYHFQRLAELYHGYHAIHRHTEDPFSVHRPETLFNIS

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

129kDa

Protein Length

1131

NCBI Gene Symbol

IFT122

Host or Source

Rabbit

Protein Name

Intraflagellar transport protein 122 homolog

Gene Name URL

IFT122

Nucleotide Accession Number

NM_052990

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
BNC471820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL
BNC040026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL
BNC800146-500 1x 500 µL

CD10 (CB-CALLA), CF680 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL
BNC940003-500 1x 500 µL

CD45RO (UCHL-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF647 conjugate, 0.1mg/mL
BNC472343-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/2343), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details