Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUP98 antibody - N-terminal region (ARP53631_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Nucleoporin 98kDa

Gene Aliases

ADIR2, NUP96, NUP196, Nup98-96

Gene ID

4928

Swiss Prot

A8KA17

Accession Number

NP_005378

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human NUP98

Target

The nuclear pore complex (NPC) is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kD nucleoporin is localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kD nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL) . This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Signal-mediated nuclear import and export proceed through the nuclear pore complex (NPC), which is comprised of approximately 50 unique proteins collectively known as nucleoporins. The 98 kD nucleoporin is generated through a biogenesis pathway that involves synthesis and proteolytic cleavage of a 186 kD precursor protein. This cleavage results in the 98 kD nucleoporin as well as a 96 kD nucleoporin, both of which are localized to the nucleoplasmic side of the NPC. Rat studies show that the 98 kD nucleoporin functions as one of several docking site nucleoporins of transport substrates. The human gene has been shown to fuse to several genes following chromsome translocatons in acute myelogenous leukemia (AML) and T-cell acute lymphocytic leukemia (T-ALL) . This gene is one of several genes located in the imprinted gene domain of 11p15.5, an important tumor-suppressor gene region. Alterations in this region have been associated with the Beckwith-Wiedemann syndrome, Wilms tumor, rhabdomyosarcoma, adrenocortical carcinoma, and lung, ovarian, and breast cancer. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.

Partner Proteins

UBC; SUMO2; SUMO3; CDC37; EED; CDC73; PAF1; ARFGEF2; FBXO6; NXF1; HDAC11; HDAC8; LMNA; HNRNPUL1; CSNK2A1; ECT2; NUP107; RAE1; SUMO1; NUMA1; rev; SIRT7; RAPGEF3; CTNNB1; NUP88; NUP159; NUP82; Nup98; Nup214; Nup188; tat; HDAC1; CREBBP; PTTG1; APC; NPM1; USP

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EELRLEDYQANRKGPQNQVGAGTTTGLFGSSPATSSATGLFSSSTTNSGF

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

98kDa

Protein Length

937

NCBI Gene Symbol

NUP98

Host or Source

Rabbit

Protein Name

CDNA FLJ77211, highly similar to Homo sapiens nucleoporin 98kDa (NUP98), transcript variant 3, mRNA EMBL BAF85571.1

Gene Name URL

NUP98

Nucleotide Accession Number

NM_005387

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD40 ORF Vector (Human) (pORF)
ORF002121 1.0 µg DNA

CD40 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
IFN-gamma Antagonist 1 acetate
MBS5818564 Inquire

IFN-gamma Antagonist 1 acetate

Sign In for Pricing
View Details
Rabbit Polyclonal Topoisomerase I Antibody
NBP3-30961-100ug 100 µg

Rabbit Polyclonal Topoisomerase I Antibody

Sign In for Pricing
View Details
RNY4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV774637 1.0 µg DNA

RNY4P1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Recombinant Human ALOX15 Protein, N-His
HB614012-01 50 µg

Recombinant Human ALOX15 Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ALOX15 Protein, N-His
HB614012-02 100 µg

Recombinant Human ALOX15 Protein, N-His

Sign In for Pricing
View Details