Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

INHA antibody - N-terminal region (ARP53597_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Inhibin, alpha

Gene ID

3623

Swiss Prot

P05111

Accession Number

NP_002182

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Horse, Pig, Rabbit, Sheep, Yeast

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human INHA

Target

INHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. The inhibin alpha subunit joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

SIAH1; TGFBR3; INHBB; INHBA; FST; ACVR2A

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 86%; Goat: 100%; Horse: 93%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 79%; Rat: 93%; Sheep: 100%; Yeast: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

40 kDa

Protein Length

366

NCBI Gene Symbol

INHA

Host or Source

Rabbit

Protein Name

Inhibin alpha chain

Gene Name URL

INHA

Nucleotide Accession Number

NM_002191

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multi well, 8 Channel Troughs, Medium Profile (22 mL), Non-sterile, Bag package, 5 pcs/pack, 2 packs/box, 5 boxes/case, 50pcs/case
360101 50 PCS/CS

Multi well, 8 Channel Troughs, Medium Profile (22 mL), Non-sterile, Bag package, 5 pcs/pack, 2 packs/box, 5 boxes/case, 50pcs/case

Sign In for Pricing
View Details
LILRB1 siRNA (Human)
CRH7395-01 15 nmol

LILRB1 siRNA (Human)

Sign In for Pricing
View Details
LILRB1 siRNA (Human)
CRH7395-02 30 nmol

LILRB1 siRNA (Human)

Sign In for Pricing
View Details
Human NT-proBNP Matched Antibody Pair Set [ABP-S-07838]
ABP-S-07838 5 Plates

Human NT-proBNP Matched Antibody Pair Set [ABP-S-07838]

Sign In for Pricing
View Details
Human Heme Oxygenase 2, Decycling (HO2) ELISA Kit
RDR-HO2-Hu-01 96 Tests

Human Heme Oxygenase 2, Decycling (HO2) ELISA Kit

Sign In for Pricing
View Details
Human Heme Oxygenase 2, Decycling (HO2) ELISA Kit
RDR-HO2-Hu-02 48 Tests

Human Heme Oxygenase 2, Decycling (HO2) ELISA Kit

Sign In for Pricing
View Details