What is the catalog number for IL13RA2 antibody - middle region (ARP53558_P050)?

The catalog number for IL13RA2 antibody - middle region (ARP53558_P050) is ARP53558_P050.

What sizes are available for IL13RA2 antibody - middle region (ARP53558_P050)?

IL13RA2 antibody - middle region (ARP53558_P050) is available in the following size(s): 100 µL.

Is IL13RA2 antibody - middle region (ARP53558_P050) in stock?

IL13RA2 antibody - middle region (ARP53558_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

IL13RA2 antibody - middle region (ARP53558_P050)

Selected Variant

ARP53558_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Interleukin 13 receptor, alpha 2

Gene Aliases

CT19, IL-13R, IL13BP, CD213A2

Gene ID

3598

Swiss Prot

Q14627

Accession Number

NP_000631

Reactivity

Human, Rat, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human IL13RA2

Target

IL13RA2 is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. IL13RA2 binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13.The protein encoded by this gene is closely related to Il13RA1, a subuint of the interleukin 13 receptor complex. This protein binds IL13 with high affinity, but lacks cytoplasmic domain, and does not appear to function as a signal mediator. It is reported to play a role in the internalization of IL13. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

UBC; IL4; IL13

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GQNIGCRFPYLEASDYKDFYICVNGSSENKPIRSSYFTFQLQNIVKPLPP

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%; Rabbit: 79%; Rat: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

44 kDa

Protein Length

380

NCBI Gene Symbol

IL13RA2

Host or Source

Rabbit

Protein Name

Interleukin-13 receptor subunit alpha-2

Gene Name URL

IL13RA2

Nucleotide Accession Number

NM_000640

Price

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hepatocyte Specific (CPS1/1022), CF647 conjugate, 0.1mg/mL

BNC471022-500 1x 500 µL