What is the catalog number for HUS1B Antibody - N-terminal region?

The catalog number for HUS1B Antibody - N-terminal region is ARP52871_P050-25UL.

What sizes are available for HUS1B Antibody - N-terminal region?

HUS1B Antibody - N-terminal region is available in the following size(s): 25 µL.

Is HUS1B Antibody - N-terminal region in stock?

HUS1B Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

What is the shelf life of this product?

Shelf life and expiration dates vary by product and are shown on the product listing and label. Products used beyond their expiration date are not eligible for performance-related returns or refunds, so please check the lot number and expiry before use.

What expression system was used for this recombinant protein?

The expression system, such as E. coli, HEK293, or insect cells, is listed on the datasheet under production details, which can affect post-translational modifications relevant to your application.

HUS1B Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

HUS1 checkpoint homolog b (S. pombe)

Gene Aliases

MGC126746, MGC126748, RP11-532F6.1

Gene ID

135458

Swiss Prot

Q8NHY5

Accession Number

NP_683762

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HUS1B

Target

HUS1Bis most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. HUS1B can interact with the check point protein RAD1 but not with RAD9. Overexpression of HUS1B has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.The protein encoded by this gene is most closely related to HUS1, a component of a cell cycle checkpoint protein complex involved in cell cycle arrest in response to DNA damage. This protein can interact with the check point protein RAD1 but not with RAD9. Overexpression of this protein has been shown to induce cell death, which suggests a related but distinct role of this protein, as compared to the HUS1.

Partner Proteins

RAD9B; RAD9A; HUS1; RAD1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol