Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ADD2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Adducin 2 (beta)

Gene Aliases

ADDB

Gene ID

119

Swiss Prot

P35612

Reactivity

Human

Immunogen

The immunogen for Anti-ADD2 antibody is: synthetic peptide directed towards the C-terminal region of Human ADDB

Target

Adducins are heteromeric proteins composed of different subunits referred to as adducin alpha, beta and gamma. The three subunits are encoded by distinct genes and belong to a family of membrane skeletal proteins involved in the assembly of spectrin-actin network in erythrocytes and at sites of cell-cell contact in epithelial tissues. While adducins alpha and gamma are ubiquitously expressed, the expression of adducin beta is restricted to brain and hematopoietic tissues. Adducin, originally purified from human erythrocytes, was found to be a heterodimer of adducins alpha and beta. Polymorphisms resulting in amino acid substitutions in these two subunits have been associated with the regulation of blood pressure in an animal model of hypertension. Heterodimers consisting of alpha and gamma subunits have also been described. Structurally, each subunit is comprised of two distinct domains. The amino-terminal region is protease resistant and globular in shape, while the carboxy-terminal region is protease sensitive. The latter contains multiple phosphorylation sites for protein kinase C, the binding site for calmodulin, and is required for association with spectrin and actin. Alternatively spliced transcript variants have been described.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SAGPQSQLLASVIAEKSRSPSTESQLMSKGDEDTKDDSEETVPNPFSQLT

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

79 kDa

Protein Length

726

NCBI Gene Symbol

ADD2

Host or Source

Rabbit

Gene Name URL

ADD2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Casr shRNA (UAS) - Lentiviral mouse Casr shRNA (UAS, GFP) plasmid
GTR15235390 1 Vial

Lentiviral mouse Casr shRNA (UAS) - Lentiviral mouse Casr shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Sheep C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit
MBS7234948-01 48 Well

Sheep C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit

Sign In for Pricing
View Details
Sheep C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit
MBS7234948-02 96 Well

Sheep C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit

Sign In for Pricing
View Details
Sheep C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit
MBS7234948-03 5x 96 Well

Sheep C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit

Sign In for Pricing
View Details
Sheep C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit
MBS7234948-04 10x 96 Well

Sheep C5a anaphylatoxin chemotactic receptor C5L2 (GPR77) ELISA Kit

Sign In for Pricing
View Details
CCDC114 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0383807 1.0 µg DNA

CCDC114 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details