Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis Myoglobin (MB)

Product Specifications

Abbreviation

Recombinant Cynomolgus monkey Myoglobin protein

Gene Name

MB

UniProt

P02150

Expression Region

2-154aa

Organism

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Target Sequence

GLSDGEWQLVLNVWGKVEADIPSHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASEDLKKHGVTVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLELISESIIQVLQSKHPGDFGADAQGAMNKALELFRNDMAAKYKELGFQG

Tag

C-terminal 6xHis-tagged

Type

In Stock Protein

Source

E.coli

Field of Research

Others

Relevance

Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.

Endotoxin

Not test

Purity

Greater than 90% as determined by SDS-PAGE.

Activity

Not Test

Form

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Molecular Weight

23.9 kDa

References & Citations

"The myoglobin of primates. 3. Cercopithecidae (Old World monkeys) : Papio anubis (olive baboon) and Macaca fascicularis (=irus, crab-eating monkey) ." Romero-Herrera A.E., Lehmann H. Biochim. Biophys. Acta 278:465-481 (1972)

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Protein Length

Full Length of Mature Protein

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gelsolin (GS) ELISA Kit
NSL2051Hu 96 Tests

Human Gelsolin (GS) ELISA Kit

Sign In for Pricing
View Details
RETN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1809707 1.0 µg DNA

RETN sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Cyclophilin 40 (PPID) (NM_005038) Human Over-expression Lysate
LS005481-100ug 100 µg

Cyclophilin 40 (PPID) (NM_005038) Human Over-expression Lysate

Sign In for Pricing
View Details
Plekhj1 Rat shRNA Plasmid (Locus ID 314634)
TL706616 1 Kit

Plekhj1 Rat shRNA Plasmid (Locus ID 314634)

Sign In for Pricing
View Details
LHCGR (LCGR, LGR2, LHRHR) discontinued
511123 100 µg

LHCGR (LCGR, LGR2, LHRHR) discontinued

Sign In for Pricing
View Details
pCMV-SPORT6-Klk7 Plasmid
PVT57917 2 µg

pCMV-SPORT6-Klk7 Plasmid

Sign In for Pricing
View Details