Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP27A1 antibody - middle region (ARP51773_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cytochrome P450, family 27, subfamily A, polypeptide 1

Gene Aliases

CTX, CP27, CYP27

Gene ID

1593

Swiss Prot

Q02318

Accession Number

NP_000775

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CYP27A1

Target

CYP27A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

PRDX4

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRI

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

57kDa

Protein Length

531

NCBI Gene Symbol

CYP27A1

Host or Source

Rabbit

Protein Name

Sterol 26-hydroxylase, mitochondrial

Gene Name URL

CYP27A1

Nucleotide Accession Number

NM_000784

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ZNF766 antibody
STJ118384 100 µl

Anti-ZNF766 antibody

Sign In for Pricing
View Details
EIF4EL3 (EIF4E2) Mouse Monoclonal Antibody [Clone ID: LBI1F11]
AMM10880V 100 µL

EIF4EL3 (EIF4E2) Mouse Monoclonal Antibody [Clone ID: LBI1F11]

Sign In for Pricing
View Details
Caspase 9 (I20), Intermediate Domain 2 (AP) discontinued
C2087-66F-AP 100 µL

Caspase 9 (I20), Intermediate Domain 2 (AP) discontinued

Sign In for Pricing
View Details
Human IL-3 ELISA Kit EZ-Set (DIY Antibody Pairs)
MBS1756349-01 5 Plates

Human IL-3 ELISA Kit EZ-Set (DIY Antibody Pairs)

Sign In for Pricing
View Details
Human IL-3 ELISA Kit EZ-Set (DIY Antibody Pairs)
MBS1756349-02 5x 5 Plates

Human IL-3 ELISA Kit EZ-Set (DIY Antibody Pairs)

Sign In for Pricing
View Details
ADK (Adenosine Kinase, AK, Adenosine 5'-phosphotransferase)
123020 100 µg

ADK (Adenosine Kinase, AK, Adenosine 5'-phosphotransferase)

Sign In for Pricing
View Details