What is the catalog number for Tceal7 Antibody - middle region?

The catalog number for Tceal7 Antibody - middle region is ARP50797_P050-25UL.

What sizes are available for Tceal7 Antibody - middle region?

Tceal7 Antibody - middle region is available in the following size(s): 25 µL.

Is Tceal7 Antibody - middle region in stock?

Tceal7 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

Tceal7 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transcription elongation factor A (SII) -like 7

Gene Aliases

1110018P05Rik

Gene ID

100040972

Swiss Prot

A3KGA4

Accession Number

NP_001120641

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Yeast

Target

Tceal7 plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Tceal7 associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Tceal7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres) and telomerase-positive cell lines.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

RLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSN

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol