What is the catalog number for ARID3C Antibody - C-terminal region?

The catalog number for ARID3C Antibody - C-terminal region is ARP50384_P050-25UL.

What sizes are available for ARID3C Antibody - C-terminal region?

ARID3C Antibody - C-terminal region is available in the following size(s): 25 µL.

Is ARID3C Antibody - C-terminal region in stock?

ARID3C Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product suitable for live cell imaging?

Suitability for live cell imaging depends on the specific reagent and conjugate used. Check the datasheet for imaging-specific validation, or contact us for guidance.

Is this product covered by a money-back guarantee?

Yes, we guarantee a full refund or store credit if this product arrives damaged beyond usability, or has a genuine performance issue under proper usage and storage, provided you report it immediately with evidence. Claims after the expiration date or due to improper storage after receipt are excluded.

Can this product be used for diagnostic or therapeutic purposes?

No. This product, like all items we supply, is intended for research laboratory use only and must not be used for diagnostics, therapeutics, treatment, or consumption by humans or animals.

ARID3C Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

AT rich interactive domain 3C (BRIGHT-like)

Gene ID

138715

Swiss Prot

A6NKF2

Accession Number

NP_001017363

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ARID3C

Target

ARID3C is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-318 AL450283.16 15235-15552 c 319-391 AL450283.16 13280-13352 c 392-575 AL450283.16 11402-11585 c 576-865 AL450283.16 10963-11252 c 866-1048 AL450283.16 9885-10067 c 1049-1138 AL450283.16 9558-9647 c 1139-1239 AL450283.16 8996-9096 c

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEING

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol