Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TMC2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Transmembrane channel-like 2

Gene Aliases

C20orf145

Gene ID

117532

Swiss Prot

Q8TDI7

Accession Number

NP_542789

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human TMC2

Target

TMC2 is considered a member of transmembrane proteins family. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. This gene is considered a member of a gene family predicted to encode transmembrane proteins. The specific function of this gene is unknown; however, expression in the inner ear suggests that it may be crucial for normal auditory function. Mutations in this gene may underlie hereditary disorders of balance and hearing. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-382 AF417580.2 1-382 383-569 DA769512.1 96-282 570-859 DA769512.1 286-575 860-2736 AF417580.2 860-2736 2737-3169 AL049712.12 30165-30597 c

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

102kDa

Protein Length

906

NCBI Gene Symbol

TMC2

Host or Source

Rabbit

Protein Name

Transmembrane channel-like protein 2

Gene Name URL

TMC2

Nucleotide Accession Number

NM_080751

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human SPTAN1 shRNA (UAS) - Lentiviral human SPTAN1 shRNA (UAS, RFP) (100)
GTR15345579 1 Vial

Lentiviral human SPTAN1 shRNA (UAS) - Lentiviral human SPTAN1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) (AP) discontinued
I8426-18B-AP 100 µL

Interleukin 4 (IL-4, B Cell Stimulatory Factor 1, BSF1, Binetrakin, HCGF, Hodgkin's Cell Growth Factor, IA Inducing Factor, Lymphocyte Stimulatory Factor 1, Macrophage Fusion Factor, Mast Cell Growth Factor 2, MCGF2, MFF, MGC79402, Pitrakinra, T Cell Growth Factor 2, TCGF2) (AP) discontinued

Sign In for Pricing
View Details
Involucrin antibody
MBS5309973-01 0.1 mg

Involucrin antibody

Sign In for Pricing
View Details
Involucrin antibody
MBS5309973-02 5x 0.1 mg

Involucrin antibody

Sign In for Pricing
View Details
AQP5 discontinued
306555 100 µL

AQP5 discontinued

Sign In for Pricing
View Details
Sart1 Mouse qPCR Template Standard (NM_016882)
MK202484 1 Kit

Sart1 Mouse qPCR Template Standard (NM_016882)

Sign In for Pricing
View Details