Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SIGLEC12 antibody - N-terminal region (ARP50183_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Sialic acid binding Ig-like lectin 12 (gene/pseudogene)

Gene Aliases

S2V, SLG, SIGLECL1, Siglec-XII

Gene ID

89858

Swiss Prot

Q96PQ1

Accession Number

NP_443729

Reactivity

Human, Rat, Cow, Horse, Pig, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SIGLEC12

Target

Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. SIGLEC12 is a member of the SIGLEC3-like subfamily of SIGLECs. SIGLEC12, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor.Western blots using four different antibodies against four unique regions of this protein target confirm the same apparent molecular weight in our tests.Sialic acid-binding immunoglobulin-like lectins (SIGLECs) are a family of cell surface proteins belonging to the immunoglobulin superfamily. They mediate protein-carbohydrate interactions by selectively binding to different sialic acid moieties present on glycolipids and glycoproteins. This gene encodes a member of the SIGLEC3-like subfamily of SIGLECs. Members of this subfamily are characterized by an extracellular V-set immunoglobulin-like domain followed by two C2-set immunoglobulin-like domains, and the cytoplasmic tyrosine-based motifs ITIM and SLAM-like. The encoded protein, upon tyrosine phosphorylation, has been shown to recruit the Src homology 2 domain-containing protein-tyrosine phosphatases SHP1 and SHP2. It has been suggested that the protein is involved in the negative regulation of macrophage signaling by functioning as an inhibitory receptor. This gene is located in a cluster with other SIGLEC3-like genes on 19q13.4. Alternatively spliced transcript variants encoding distinct isoforms have been described for this gene.

Partner Proteins

CMAS; PTPN6; PTPN11

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GRFLLLGDPQTNNCSLSIRDARKGDSGKYYFQVERGSRKWNYIYDKLSVH

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 77%; Horse: 83%; Human: 100%; Pig: 86%; Rat: 77%; Zebrafish: 82%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

63kDa

Protein Length

595

NCBI Gene Symbol

SIGLEC12

Host or Source

Rabbit

Protein Name

Sialic acid-binding Ig-like lectin 12

Gene Name URL

SIGLEC12

Nucleotide Accession Number

NM_053003

More Discoveries

Explore Other Products

Browse additional items from our catalog

SOCS4, ID (SOCS4, SOCS7, Suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7) (MaxLight 650)
MBS6349746-01 0.1 mL

SOCS4, ID (SOCS4, SOCS7, Suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7) (MaxLight 650)

Sign In for Pricing
View Details
SOCS4, ID (SOCS4, SOCS7, Suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7) (MaxLight 650)
MBS6349746-02 5x 0.1 mL

SOCS4, ID (SOCS4, SOCS7, Suppressor of cytokine signaling 4, Suppressor of cytokine signaling 7) (MaxLight 650)

Sign In for Pricing
View Details
Arginine (Arg) BioAssayTM ECL ELISA Kit (General)
365735 96 Tests

Arginine (Arg) BioAssayTM ECL ELISA Kit (General)

Sign In for Pricing
View Details
Mouse Snrnp70 activation kit by CRISPRa
GA204010 1 Kit

Mouse Snrnp70 activation kit by CRISPRa

Sign In for Pricing
View Details
VN2R15P sgRNA CRISPR Lentivector set (Human)
K2615801 3x 1.0 µg

VN2R15P sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit IgA-Immunoglobulin A- ELISA Kit
E-EL-RB1208-01 24 Tests

Rabbit IgA-Immunoglobulin A- ELISA Kit

Sign In for Pricing
View Details