Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GDAP1L1 antibody - N-terminal region (ARP49791_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Ganglioside induced differentiation associated protein 1-like 1

Gene Aliases

DJ881L22.1, dJ995J12.1.1

Gene ID

78997

Swiss Prot

Q96MZ0

Accession Number

NP_076939

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human GDAP1L1

Target

The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1) . A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. GDAP1L1 is similar in sequence to the human GDAP1 protein.The ganglioside GD3 synthase causes cell differentiation with neurite sprouting when transfected into the mouse neuroblastoma cell line Neuro2a. After differentiation, the expression of several genes is upregulated, including one that encodes a protein termed ganglioside-induced differentiation-associated protein 1 (Gdap1) . A similar gene was found in humans, and mutations in the human gene are associated with Charcot-Marie-Tooth type 4A disease. The protein encoded by this gene is similar in sequence to the human GDAP1 protein.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ERDVSLPQSEHKEPWFMRLNLGEEVPVIIHRDNIISDYDQIIDYVERTFT

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

42kDa

Protein Length

367

NCBI Gene Symbol

GDAP1L1

Host or Source

Rabbit

Protein Name

Ganglioside-induced differentiation-associated protein 1-like 1

Gene Name URL

GDAP1L1

Nucleotide Accession Number

NM_024034

More Discoveries

Explore Other Products

Browse additional items from our catalog

ATOH8 Protein Vector (Mouse) (pPB-C-His)
PV157118 500 ng

ATOH8 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
MUSK Blocking Peptide
MBS9620258-01 1 mg

MUSK Blocking Peptide

Sign In for Pricing
View Details
MUSK Blocking Peptide
MBS9620258-02 5x 1 mg

MUSK Blocking Peptide

Sign In for Pricing
View Details
MRPL49 Peptide - N-terminal region
MBS3239585-01 0.1 mg

MRPL49 Peptide - N-terminal region

Sign In for Pricing
View Details
MRPL49 Peptide - N-terminal region
MBS3239585-02 5x 0.1 mg

MRPL49 Peptide - N-terminal region

Sign In for Pricing
View Details
Rabbit Polyclonal Dynorphin Antibody
NBP2-49081 0.1 mL

Rabbit Polyclonal Dynorphin Antibody

Sign In for Pricing
View Details