Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZP4 antibody - N-terminal region (ARP49639_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Zona pellucida glycoprotein 4

Gene Aliases

ZBP, ZP1, ZPB, Zp-4

Gene ID

57829

Swiss Prot

Q12836

Accession Number

NP_067009

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ZP4

Target

The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix.The zona pellucida is an extracellular matrix that surrounds the oocyte and early embryo. It is composed primarily of three or four glycoproteins with various functions during fertilization and preimplantation development. The nascent protein contains a N-terminal signal peptide sequence, a conserved ZP domain, a consensus furin cleavage site, and a C-terminal transmembrane domain. It is hypothesized that furin cleavage results in release of the mature protein from the plasma membrane for subsequent incorporation into the zona pellucida matrix. However, the requirement for furin cleavage in this process remains controversial based on mouse studies. Previously, this gene has been referred to as ZP1 or ZPB and thought to have similar functions as mouse Zp1. However, a human gene with higher similarity and chromosomal synteny to mouse Zp1 has been assigned the symbol ZP1 and this gene has been assigned the symbol ZP4. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

FURIN

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MWLLRCVLLCVSLSLAVSGQHKPEAPDYSSVLHCGPWSFQFAVNLNQEAT

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

49kDa

Protein Length

540

NCBI Gene Symbol

ZP4

Host or Source

Rabbit

Protein Name

Zona pellucida sperm-binding protein 4

Gene Name URL

ZP4

Nucleotide Accession Number

NM_021186

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cklf (NM_139111) Rat Tagged ORF Clone Lentiviral Particle
RR212897L3V 200 µL

Cklf (NM_139111) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Rabbit Polyclonal Protein Kinase A regulatory subunit I alpha Antibody [Alexa Fluor 594]
NBP3-00289AF594 0.1 mL

Rabbit Polyclonal Protein Kinase A regulatory subunit I alpha Antibody [Alexa Fluor 594]

Sign In for Pricing
View Details
NEDD9 3'UTR GFP Stable Cell Line
TU065554 1.0 mL

NEDD9 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Polyclonal Ribonuclease A Antibody
NB600-648-100ug 100 µg

Rabbit Polyclonal Ribonuclease A Antibody

Sign In for Pricing
View Details
Fam19a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4753706 1.0 µg DNA

Fam19a4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
CNTROB Knockout 786-O Polyclonal Cells
ARG4867 1 Million

CNTROB Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details