Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

B3GALT1 antibody - C-terminal region (ARP49607_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 1

Gene Aliases

Beta3Gal-T1

Gene ID

8708

Swiss Prot

Q9Y5Z6

Accession Number

NP_066191

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human B3GALT1

Target

B3GALT1 is a member of the beta-1,3-galactosyltransferase (beta3GalT) family. This family are type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine) . The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5) . This gene is expressed exclusively in the brain. The encoded protein shows strict donor substrate specificity for UDP-galactose.This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. This family encodes type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates (UDP-galactose and UDP-N-acetylglucosamine) and different acceptor sugars (N-acetylglucosamine, galactose, N-acetylgalactosamine) . The beta3GalT genes are distantly related to the Drosophila Brainiac gene and have the protein coding sequence contained in a single exon. The beta3GalT proteins also contain conserved sequences not found in the beta4GalT or alpha3GalT proteins. The carbohydrate chains synthesized by these enzymes are designated as type 1, whereas beta4GalT enzymes synthesize type 2 carbohydrate chains. The ratio of type 1:type 2 chains changes during embryogenesis. By sequence similarity, the beta3GalT genes fall into at least two groups: beta3GalT4 and 4 other beta3GalT genes (beta3GalT1-3, beta3GalT5) . This gene is expressed exclusively in the brain. The encoded protein shows strict donor substrate specificity for UDP-galactose.

Partner Proteins

UGT1A1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YKTSLHTRLLHLEDVYVGLCLRKLGIHPFQNSGFNHWKMAYSLCRYRRVI

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

38kDa

Protein Length

326

NCBI Gene Symbol

B3GALT1

Host or Source

Rabbit

Protein Name

Beta-1,3-galactosyltransferase 1

Gene Name URL

B3GALT1

Nucleotide Accession Number

NM_020981

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lnx1 Rat siRNA Oligo Duplex (Locus ID 360926)
SR512410 1 Kit

Lnx1 Rat siRNA Oligo Duplex (Locus ID 360926)

Sign In for Pricing
View Details
ITIH5 (NM_032817) Human Tagged ORF Clone Lentiviral Particle
RC214478L3V 200 µL

ITIH5 (NM_032817) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
6430548M08Rik (NM_001163762) Mouse Tagged ORF Clone Lentiviral Particle
MR223780L3V 200 µL

6430548M08Rik (NM_001163762) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
STK39 (STK39, SPAK, STE20/SPS1-related proline-alanine-rich protein kinase, DCHT, Serine/threonine-protein kinase 39)
031267 100 µL

STK39 (STK39, SPAK, STE20/SPS1-related proline-alanine-rich protein kinase, DCHT, Serine/threonine-protein kinase 39)

Sign In for Pricing
View Details
Flt3 ligand / FLT3LG Monoclonal Antibody
ANT-12217-50ug 50 µg

Flt3 ligand / FLT3LG Monoclonal Antibody

Sign In for Pricing
View Details
Sialokinin-2
MBS8247044-01 1 mg

Sialokinin-2

Sign In for Pricing
View Details