Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SEMA6D antibody - N-terminal region (ARP49584_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Sema domain, transmembrane domain (TM), and cytoplasmic domain, (semaphorin) 6D

Gene Aliases

FLJ11598, KIAA1479

Gene ID

80031

Swiss Prot

A6NM95

Accession Number

NP_705872

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SEMA6D

Target

Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphorin domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. This gene encodes a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.

Partner Proteins

PLXNA1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

65kDa

Protein Length

597

NCBI Gene Symbol

SEMA6D

Host or Source

Rabbit

Protein Name

Semaphorin-6D Ensembl ENSP00000453661 Ensembl ENSP00000348276

Gene Name URL

SEMA6D

Nucleotide Accession Number

NM_153619

More Discoveries

Explore Other Products

Browse additional items from our catalog

VAPA (NM_003574) Human Over-expression Lysate
LC429151 20 µg

VAPA (NM_003574) Human Over-expression Lysate

Sign In for Pricing
View Details
OCT-4 (POU5F1, POU domain, class 5, transcription factor 1, NF-A3, Oct3, Oct-3, Oct3/4, Oct-3/4, Octamer-binding transcription factor 3, Otf3, Otf-3, Otf3g, Otf3-rs7, Otf4, Otf-4) (MaxLight 405)
MBS6245124-01 0.1 mL

OCT-4 (POU5F1, POU domain, class 5, transcription factor 1, NF-A3, Oct3, Oct-3, Oct3/4, Oct-3/4, Octamer-binding transcription factor 3, Otf3, Otf-3, Otf3g, Otf3-rs7, Otf4, Otf-4) (MaxLight 405)

Sign In for Pricing
View Details
OCT-4 (POU5F1, POU domain, class 5, transcription factor 1, NF-A3, Oct3, Oct-3, Oct3/4, Oct-3/4, Octamer-binding transcription factor 3, Otf3, Otf-3, Otf3g, Otf3-rs7, Otf4, Otf-4) (MaxLight 405)
MBS6245124-02 5x 0.1 mL

OCT-4 (POU5F1, POU domain, class 5, transcription factor 1, NF-A3, Oct3, Oct-3, Oct3/4, Oct-3/4, Octamer-binding transcription factor 3, Otf3, Otf-3, Otf3g, Otf3-rs7, Otf4, Otf-4) (MaxLight 405)

Sign In for Pricing
View Details
SLC9A3R2 Polyclonal Antibody
CAC14689-01 50 µg

SLC9A3R2 Polyclonal Antibody

Sign In for Pricing
View Details
SLC9A3R2 Polyclonal Antibody
CAC14689-02 100 µg

SLC9A3R2 Polyclonal Antibody

Sign In for Pricing
View Details
Grik2 (NM_010349) Mouse Tagged ORF Clone
MR219233 10 µg

Grik2 (NM_010349) Mouse Tagged ORF Clone

Sign In for Pricing
View Details