Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

JPH3 antibody - N-terminal region (ARP49534_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Junctophilin 3

Gene Aliases

JP3, HDL2, JP-3, TNRC22, CAGL237

Gene ID

57338

Swiss Prot

Q8WXH2

Accession Number

NP_065706

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human JPH3

Target

Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. JPH3 is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. CAG/CTG repeat expansions at the Huntington's disease (HD) -like 2 locus have been identified in the gene that encodes JPH3 protein. Junctional complexes between the plasma membrane and endoplasmic/sarcoplasmic reticulum are a common feature of all excitable cell types and mediate cross talk between cell surface and intracellular ion channels. The protein encoded by this gene is a component of junctional complexes and is composed of a C-terminal hydrophobic segment spanning the endoplasmic/sarcoplasmic reticulum membrane and a remaining cytoplasmic domain that shows specific affinity for the plasma membrane. CAG/CTG repeat expansions at the Huntington's disease (HD) -like 2 locus have been identified in this gene, which is a member of the junctophilin gene family. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

PPP1CA; SMAD3; BGN; STK24

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SSGGRFNFDDGGSYCGGWEDGKAHGHGVCTGPKGQGEYTGSWSHGFEVLG

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

81kDa

Protein Length

748

NCBI Gene Symbol

JPH3

Host or Source

Rabbit

Protein Name

Junctophilin-3

Gene Name URL

JPH3

Nucleotide Accession Number

NM_020655

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Mpped1 Pre-designed siRNA Set B
SI108643B 1 Each

Mouse Mpped1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SLC44A1 (Solute Carrier Family 44, Member 1, CD92, CDW92, CHTL1, CTL1, RP11-287A8.1) (MaxLight 750)
MBS6240574-01 0.1 mL

SLC44A1 (Solute Carrier Family 44, Member 1, CD92, CDW92, CHTL1, CTL1, RP11-287A8.1) (MaxLight 750)

Sign In for Pricing
View Details
SLC44A1 (Solute Carrier Family 44, Member 1, CD92, CDW92, CHTL1, CTL1, RP11-287A8.1) (MaxLight 750)
MBS6240574-02 5x 0.1 mL

SLC44A1 (Solute Carrier Family 44, Member 1, CD92, CDW92, CHTL1, CTL1, RP11-287A8.1) (MaxLight 750)

Sign In for Pricing
View Details
Robotic Tips (W/O Filter)
SL-RCT-250-B 96 PCS/Rack, 50 Racks/CTN

Robotic Tips (W/O Filter)

Sign In for Pricing
View Details
IL-33 monoclonal antibody (03)
ENZ-ABS948-0100 100 µL

IL-33 monoclonal antibody (03)

Sign In for Pricing
View Details
hsa-miR-5008-3p miRNA Antagomir
MNH02796 2x 5.0 nmol

hsa-miR-5008-3p miRNA Antagomir

Sign In for Pricing
View Details