Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UGT1A7 antibody - N-terminal region (ARP49438_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

UDP glucuronosyltransferase 1 family, polypeptide A7

Gene Aliases

GNT1, UGT1, UDPGT, UGT1A, UGT1G, UGT-1A, UGT-1G, UGT1.1, UGT1.7, UGT1A1, UGT1-01, UGT1-07, hUG-BR1, UDPGT 1-7

Gene ID

54577

Swiss Prot

Q5DSZ7

Accession Number

NP_061950

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human UGT1A7

Target

UGT1A7 is an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols.This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene has moderate glucuronidase activity with phenols. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSN

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

57kDa

Protein Length

530

NCBI Gene Symbol

UGT1A7

Host or Source

Rabbit

Protein Name

UDP glycosyltransferase 1 family polypeptide A7 EMBL AAR95643.1

Gene Name URL

UGT1A7

Nucleotide Accession Number

NM_019077

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human PLTP protein, His-tagged
PLTP-1800H 25 µg

Recombinant Human PLTP protein, His-tagged

Sign In for Pricing
View Details
Mmu-miR-7222-5p miRNA Inhibitor
CIM1698-01 10 nmol

Mmu-miR-7222-5p miRNA Inhibitor

Sign In for Pricing
View Details
Mmu-miR-7222-5p miRNA Inhibitor
CIM1698-02 20 nmol

Mmu-miR-7222-5p miRNA Inhibitor

Sign In for Pricing
View Details
Donkey Chondrolectin (CHODL) ELISA Kit
MBS9932788 Inquire

Donkey Chondrolectin (CHODL) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Drebrin 1 Antibody (DBN1/2880) [PE]
NBP2-79902PE 0.1 mL

Mouse Monoclonal Drebrin 1 Antibody (DBN1/2880) [PE]

Sign In for Pricing
View Details
ov-VEGF-E (Orf virus) (Recombinant) Human
GWB-C8AD60 0.005 mg

ov-VEGF-E (Orf virus) (Recombinant) Human

Sign In for Pricing
View Details