Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal-Free Fas Ligand, Mouse (His)

The cytoplasmic form of Fas ligand protein exerts powerful effects by inhibiting gene transcription. This protein plays a crucial role in regulating cellular processes by inhibiting the expression of specific genes. Animal-Free Fas Ligand Protein, Mouse (His) is the recombinant mouse-derived animal-FreeFas Ligand protein, expressed by E. coli , with N-His labeled tag. This product is for cell culture use only.

Product Specifications

Product Name Alternative

Animal-Free Fas Ligand Protein, Mouse (His), Mouse, E. coli

UNSPSC

12352202

Type

Recombinant Proteins

Assay Protocol

https://www.medchemexpress.com/cytokines/animal-free-fas-ligand-protein-mouse-his.html

Purity

98.0

Smiles

QIANPSTPSEKKEPRSVAHLTGNPHSRSIPLEWEDTYGTALISGVKYKKGGLVINETGLYFVYSKVYFRGQSCNNQPLNHKVYMRNSKYPEDLVLMEEKRLNYCTTGQIWAHSSYLGAVFNLTSADHLYVNISQLSLINFEESKTFFGLYKL

Molecular Formula

14103 (Gene_ID) Q544E9 (Q128-L279) (Accession)

Molecular Weight

Approximately 17-25 kDa, based on SDS-PAGE under reducing conditions.

Shipping Conditions

Room temperature in continental US; may vary elsewhere.

Storage Conditions

Stored at -20°C for 2 years

Scientific Category

Recombinant Proteins

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGLN1 (NM_022051) Human Over-expression Lysate
LC402911 20 µg

EGLN1 (NM_022051) Human Over-expression Lysate

Sign In for Pricing
View Details
FUT11 (NM_173540) Human Recombinant Protein
TP306082M 100 µg

FUT11 (NM_173540) Human Recombinant Protein

Sign In for Pricing
View Details
B4GALT4 (NM_003778) Human Recombinant Protein
TP720426L 500 µg

B4GALT4 (NM_003778) Human Recombinant Protein

Sign In for Pricing
View Details
MBD2 Recombinant Rabbit Monoclonal Antibody [JE57-73]
ET7111-40 100 µL

MBD2 Recombinant Rabbit Monoclonal Antibody [JE57-73]

Sign In for Pricing
View Details
Anti-Cleaved PARP Antibody [SU0314]
ET1608-10TR 20 µL

Anti-Cleaved PARP Antibody [SU0314]

Sign In for Pricing
View Details
Lauramine Oxide
TRC-L178530-25G 25 g

Lauramine Oxide

Sign In for Pricing
View Details