What is the catalog number for Pigw Antibody - middle region?

The catalog number for Pigw Antibody - middle region is ARP49146_P050-25UL.

What sizes are available for Pigw Antibody - middle region?

Pigw Antibody - middle region is available in the following size(s): 25 µL.

Is Pigw Antibody - middle region in stock?

Pigw Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Pigw Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Phosphatidylinositol glycan anchor biosynthesis, class W

Gene Aliases

Pigw

Gene ID

378774

Swiss Prot

Q7TSN4

Accession Number

NP_919443

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Yeast, Zebrafish

Immunogen

The immunogen is a synthetic peptide corresponding to a region of Rat

Target

Pigw is a probable acetyltransferase, which acetylates the inositol ring of phosphatidylinositol during biosynthesis of GPI-anchor. Acetylation during GPI-anchor biosynthesis is not essential for the subsequent mannosylation and is usually removed soon after the attachment of GPIs to proteins

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SIGYQEHSTEYGVHWNFFFTIIVVKLITSLLLIIFPLNKSWIVAISITVL

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol