What is the catalog number for B3GNT4 Antibody - N-terminal region?

The catalog number for B3GNT4 Antibody - N-terminal region is ARP48944_P050-25UL.

What sizes are available for B3GNT4 Antibody - N-terminal region?

B3GNT4 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is B3GNT4 Antibody - N-terminal region in stock?

B3GNT4 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Do you offer custom or private-label production of this type of product?

Yes, custom antibody development and private-label production services are available. Contact our sales team to discuss your target, timeline, and quantity requirements.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

B3GNT4 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

UDP-GlcNAc:betaGal beta-1,3-N-acetylglucosaminyltransferase 4

Gene Aliases

B3GN-T4, beta3Gn-T4

Gene ID

79369

Swiss Prot

Q9C0J1

Accession Number

NP_110392

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human B3GNT4

Target

B3GNT4 is a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The protein is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.This gene encodes a member of the beta-1,3-N-acetylglucosaminyltransferase protein family. The encoded enzyme is involved in the biosynthesis of poly-N-acetyllactosamine chains and prefers lacto-N-neotetraose as a substrate. It is a type II transmembrane protein.

Partner Proteins

CUL4B; GOLM1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MLPPQPSAAHQGRGGRSGLLPKGPAMLCRLCWLVSYSLAVLLLGCLLFLR

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol