Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COQ3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Coenzyme Q3 homolog, methyltransferase (S. cerevisiae)

Gene Aliases

DHHBMT, bA9819.1, DHHBMTASE, UG0215E05

Gene ID

51805

Swiss Prot

Q9NZJ6

Accession Number

NP_059117

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Human COQ3

Target

Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes (Jonassen and Clarke, 2000 [PubMed 10777520]) . This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

CGGGLLTEPLGRLGASVIGIDPVDENIKTAQCHKSFDPVLDKRIEYRVCS

Applications

WB

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

40kDa

Protein Length

369

NCBI Gene Symbol

COQ3

Host or Source

Rabbit

Protein Name

Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial

Gene Name URL

COQ3

More Discoveries

Explore Other Products

Browse additional items from our catalog

Arid1b sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4978602 1.0 µg DNA

Arid1b sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Goat anti Guinea Pig IgG (H + L)
MBS539813-01 2 mg

Goat anti Guinea Pig IgG (H + L)

Sign In for Pricing
View Details
Goat anti Guinea Pig IgG (H + L)
MBS539813-02 5x 2 mg

Goat anti Guinea Pig IgG (H + L)

Sign In for Pricing
View Details
Cyclin D3 (CCND3) (NM_001136126) Human 3' UTR Clone
SC212079 10 µg

Cyclin D3 (CCND3) (NM_001136126) Human 3' UTR Clone

Sign In for Pricing
View Details
ZNF300P1 Protein Vector (Human) (pPM-C-His)
PV060160 500 ng

ZNF300P1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Guinea Pig Substance P, SP ELISA Kit
MBS706109-01 24 Well (LIMIT 1)

Guinea Pig Substance P, SP ELISA Kit

Sign In for Pricing
View Details