What is the catalog number for COQ3 Antibody - N-terminal region (ARP48796_P050)?

The catalog number for COQ3 Antibody - N-terminal region (ARP48796_P050) is ARP48796_P050.

What sizes are available for COQ3 Antibody - N-terminal region (ARP48796_P050)?

COQ3 Antibody - N-terminal region (ARP48796_P050) is available in the following size(s): 100 µL.

Is COQ3 Antibody - N-terminal region (ARP48796_P050) in stock?

COQ3 Antibody - N-terminal region (ARP48796_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product classed as hazardous or restricted for shipping?

Some products are subject to special import/export regulations, dangerous goods handling, or licensing requirements. Where this applies, it’s noted on the product page, and any required extra documents or fees will be confirmed with you before dispatch, never added without your consent.

Can you help me confirm if this product is right for my specific experiment?

Yes, contact us with details of your sample type, species, and intended application, and our specialists will confirm suitability or suggest an alternative from our supplier network if this isn’t the best fit.

What is the purity of this recombinant protein?

Purity, typically assessed by SDS-PAGE, is listed on the datasheet under quality control data.

COQ3 Antibody - N-terminal region (ARP48796_P050)

Selected Variant

ARP48796_P050

Size: 100 µL

Product Specifications

CAS Number

9007-83-4

Gene Name

Coenzyme Q3 homolog, methyltransferase (S. cerevisiae)

Gene Aliases

DHHBMT, bA9819.1, DHHBMTASE, UG0215E05

Gene ID

51805

Swiss Prot

Q9NZJ6

Accession Number

NP_059117

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of Human COQ3

Target

Ubiquinone, also known as coenzyme Q, or Q, is a critical component of the electron transport pathways of both eukaryotes and prokaryotes (Jonassen and Clarke, 2000 [PubMed 10777520]) . This lipid consists of a hydrophobic isoprenoid tail and a quinone head group. The tail varies in length depending on the organism, but its purpose is to anchor coenzyme Q to the membrane. The quinone head group is responsible for the activity of coenzyme Q in the respiratory chain. The S. cerevisiae COQ3 gene encodes an O-methyltransferase required for 2 steps in the biosynthetic pathway of coenzyme Q. This enzyme methylates an early coenzyme Q intermediate, 3,4-dihydroxy-5-polyprenylbenzoic acid, as well as the final intermediate in the pathway, converting demethyl-ubiquinone to coenzyme Q. The COQ3 gene product is also capable of methylating the distinct prokaryotic early intermediate 2-hydroxy-6-polyprenyl phenol.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ARLYSTSQTTVDSGEVKTFLALAHKWWDEQGVYAPLHSMNDLRVPFIRDN

Applications

Purification

Affinity purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 92%; Pig: 79%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

40kDa

Protein Length

369

NCBI Gene Symbol

COQ3

Host or Source

Rabbit

Protein Name

Hexaprenyldihydroxybenzoate methyltransferase, mitochondrial

Gene Name URL