Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA4 antibody - C-terminal region (ARP48555_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Glutathione S-transferase alpha 4

Gene Aliases

GTA4, GSTA4-4

Gene ID

2941

Swiss Prot

O15217

Accession Number

NP_001503

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GSTA4

Target

GSTA4 is a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis.Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, which are located in a cluster on chromosome 6, are highly related and encode enzymes with glutathione peroxidase activity that function in the detoxification of lipid peroxidation products. Reactive electrophiles produced by oxidative metabolism have been linked to a number of degenerative diseases including Parkinson's disease, Alzheimer's disease, cataract formation, and atherosclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

C2orf50; GSTA4; GSTA2; BAG3; UBC

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LSAFPFLQEYTVKLSNIPTIKRFLEPGSKKKPPPDEIYVRTVYNIFRP

Applications

WB, IHC

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 100%; Rat: 79%; Zebrafish: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

26kDa

Protein Length

222

NCBI Gene Symbol

GSTA4

Host or Source

Rabbit

Protein Name

Glutathione S-transferase A4

Gene Name URL

GSTA4

Nucleotide Accession Number

NM_001512

More Discoveries

Explore Other Products

Browse additional items from our catalog

Raf1, NT (Raf1, Craf, RAF proto-oncogene serine/threonine-protein kinase, Proto-oncogene c-RAF, Raf-1) (MaxLight 405) discontinued
040808-ML405 100 µL

Raf1, NT (Raf1, Craf, RAF proto-oncogene serine/threonine-protein kinase, Proto-oncogene c-RAF, Raf-1) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Transmembrane Protein 173 (TMEM173)
MBS2009738-01 0.01 mg

Recombinant Transmembrane Protein 173 (TMEM173)

Sign In for Pricing
View Details
Recombinant Transmembrane Protein 173 (TMEM173)
MBS2009738-02 0.05 mg

Recombinant Transmembrane Protein 173 (TMEM173)

Sign In for Pricing
View Details
Recombinant Transmembrane Protein 173 (TMEM173)
MBS2009738-03 0.1 mg

Recombinant Transmembrane Protein 173 (TMEM173)

Sign In for Pricing
View Details
Recombinant Transmembrane Protein 173 (TMEM173)
MBS2009738-04 0.2 mg

Recombinant Transmembrane Protein 173 (TMEM173)

Sign In for Pricing
View Details
Recombinant Transmembrane Protein 173 (TMEM173)
MBS2009738-05 0.5 mg

Recombinant Transmembrane Protein 173 (TMEM173)

Sign In for Pricing
View Details