Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTT1 antibody - C-terminal region (ARP48490_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Glutathione S-transferase theta 1

Gene ID

2952

Swiss Prot

P30711

Accession Number

NP_000844

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human GSTT1

Target

Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis.Glutathione S-transferase (GST) theta 1 (GSTT1) is a member of a superfamily of proteins that catalyze the conjugation of reduced glutathione to a variety of electrophilic and hydrophobic compounds. Human GSTs can be divided into five main classes: alpha, mu, pi, theta, and zeta. The theta class includes GSTT1 and GSTT2. The GSTT1 and GSTT2 share 55% amino acid sequence identity and both of them were claimed to have an important role in human carcinogenesis. The GSTT1 gene is located approximately 50kb away from the GSTT2 gene. The GSTT1 and GSTT2 genes have a similar structure, being composed of five exons with identical exon/intron boundaries. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

GSTO1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

TWRQRVEAAVGEDLFQEAHEVILKAKDFPPADPTIKQKLMPWVLAMIR

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 79%; Dog: 86%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Rabbit: 79%; Rat: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

27kDa

Protein Length

240

NCBI Gene Symbol

GSTT1

Host or Source

Rabbit

Protein Name

Glutathione S-transferase theta-1

Gene Name URL

GSTT1

Nucleotide Accession Number

NM_000853

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL19P6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1920908 1.0 µg DNA

RPL19P6 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
HCRTR1, ID (HCRTR1, Orexin receptor type 1, Hypocretin receptor type 1)
MBS643488-01 0.2 mL

HCRTR1, ID (HCRTR1, Orexin receptor type 1, Hypocretin receptor type 1)

Sign In for Pricing
View Details
HCRTR1, ID (HCRTR1, Orexin receptor type 1, Hypocretin receptor type 1)
MBS643488-02 5x 0.2 mL

HCRTR1, ID (HCRTR1, Orexin receptor type 1, Hypocretin receptor type 1)

Sign In for Pricing
View Details
Dog Spleen Total Protein
DT-701 1 mg

Dog Spleen Total Protein

Sign In for Pricing
View Details
PPP1R1B (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B, DARPP-32, DARPP32, FLJ20940) (PE)
250394-PE 100 µL

PPP1R1B (Protein Phosphatase 1, Regulatory (Inhibitor) Subunit 1B, DARPP-32, DARPP32, FLJ20940) (PE)

Sign In for Pricing
View Details
Zfx siRNA Oligos set (Rat)
51220176 3x 5 nmol

Zfx siRNA Oligos set (Rat)

Sign In for Pricing
View Details