What is the catalog number for WDR34 Antibody - C-terminal region?

The catalog number for WDR34 Antibody - C-terminal region is ARP48430_P050-25UL.

What sizes are available for WDR34 Antibody - C-terminal region?

WDR34 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is WDR34 Antibody - C-terminal region in stock?

WDR34 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

What is the immunogen used to generate this antibody?

Immunogen or antigen details used to raise this antibody are listed on the product datasheet under immunogen information.

What is the recommended positive control for this assay?

A recommended positive control, where one is specified by the manufacturer, is listed on the datasheet or in the assay protocol.

How should this product be stored?

Storage conditions depend on the specific reagent and are listed on the product datasheet, with most antibodies and proteins requiring -20°C unless stated otherwise. It is your responsibility to store the product correctly immediately upon receipt; damage from improper storage after delivery is not eligible for replacement.

WDR34 Antibody - C-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

WD repeat domain 34

Gene Aliases

DIC5, WDR34, FAP133, SRTD11, CFAP133, bA216B9.3

Gene ID

89891

Swiss Prot

Q96EX3

Accession Number

NP_443076

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human WDR34

Target

WDR34 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-63 BI910783.1 91-153 64-301 BC011874.2 1-238 302-479 BG177634.1 145-322 480-1063 AL555205.3 287-870 1064-1818 BC011874.2 1001-1755

Partner Proteins

TRIM54; COIL; UBC; TAB3; TAB2; TRAF6; MAP3K7; MAPK6; Dynll1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SLKYLFAVRWSPVRPLVFAAASGKGDVQLFDLQKSSQKPTVLIKQTQDES

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol