Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PFN1 antibody - N-terminal region (ARP48269_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Profilin 1

Gene Aliases

ALS18

Gene ID

5216

Swiss Prot

P07737

Accession Number

NP_005013

Reactivity

Human, Mouse, Rat, Cow, Guinea Pig, Horse, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human PFN1

Target

PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.The protein encoded by this gene is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

UBC; FUS; STUB1; SUMO1; NEDD8; MDM2; ASB12; ASB2; ASB1; YWHAQ; SRPK1; ESR1; RAD52; RAD51; ACTB; VCAM1; ITGA4; FN1; ATF2; LIG4; SET; ACAA2; LOC440434; MRPL53; SRPRB; CAND1; CUL3; CDK2; ISG15; ELAVL1; AI837181; Akap12; Csnk1e; Mapk13; UCHL5; WIPF2; LRIF1; M

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 91%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

15 kDa

Protein Length

140

NCBI Gene Symbol

PFN1

Host or Source

Rabbit

Protein Name

Profilin-1

Gene Name URL

PFN1

Nucleotide Accession Number

NM_005022

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRASP65 (GORASP1) (NM_001278790) Human Untagged Clone
SC335080 10 µg

GRASP65 (GORASP1) (NM_001278790) Human Untagged Clone

Sign In for Pricing
View Details
PPP2R2D 3'UTR Luciferase Stable Cell Line
TU018683 1.0 mL

PPP2R2D 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PLK2, CT (Serine/Threonine-protein Kinase PLK2, Polo-like Kinase 2, PLK-2, Serine/Threonine-protein Kinase SNK, Serum-inducible Kinase, SNK) (MaxLight 750)
MBS6493997-01 0.1 mL

PLK2, CT (Serine/Threonine-protein Kinase PLK2, Polo-like Kinase 2, PLK-2, Serine/Threonine-protein Kinase SNK, Serum-inducible Kinase, SNK) (MaxLight 750)

Sign In for Pricing
View Details
PLK2, CT (Serine/Threonine-protein Kinase PLK2, Polo-like Kinase 2, PLK-2, Serine/Threonine-protein Kinase SNK, Serum-inducible Kinase, SNK) (MaxLight 750)
MBS6493997-02 5x 0.1 mL

PLK2, CT (Serine/Threonine-protein Kinase PLK2, Polo-like Kinase 2, PLK-2, Serine/Threonine-protein Kinase SNK, Serum-inducible Kinase, SNK) (MaxLight 750)

Sign In for Pricing
View Details
Nme6 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4669602 1.0 µg DNA

Nme6 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Phospho-RPA32/RPA2 (Ser4/Ser8) Antibody
AF3721-01 100 µL

Phospho-RPA32/RPA2 (Ser4/Ser8) Antibody

Sign In for Pricing
View Details