Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IL28RA antibody - N-terminal region (ARP48069_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Interleukin 28 receptor, alpha (interferon, lambda receptor)

Gene Aliases

IFNLR, LICR2, IL28RA, CRF2/12, IL-28R1

Gene ID

163702

Swiss Prot

Q5VTX8

Accession Number

NP_775087

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human IL28RA

Target

IL28RA belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB) . The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29) . The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. The protein encoded by this gene belongs to the class II cytokine receptor family. This protein forms a receptor complex with interleukine 10 receptor, beta (IL10RB) . The receptor complex has been shown to interact with three closely related cytokines, including interleukin 28A (IL28A), interleukin 28B (IL28B), and interleukin 29 (IL29) . The expression of all three cytokines can be induced by viral infection. The cells overexpressing this protein have been found to have enhanced responses to IL28A and IL29, but decreased response to IL28B. Three alternatively spliced transcript variants encoding distinct isoforms have been reported.

Partner Proteins

IFNLR1; IFNL1; IFNL2; LSM8

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

EECAGTKELLCSMMCLKKQDLYNKFKGRVRTVSPSSKSPWVESEYLDYLF

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 92%; Dog: 100%; Guinea Pig: 100%; Horse: 86%; Human: 100%; Mouse: 77%; Rabbit: 86%; Rat: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

57 kDa

Protein Length

491

NCBI Gene Symbol

IFNLR1

Host or Source

Rabbit

Protein Name

Interleukin-28 receptor subunit alpha

Gene Name URL

IFNLR1

Nucleotide Accession Number

NM_173064

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ku70/XRCC6 Affinity Purified Polyclonal Ab
AF5597 100 µg

Human Ku70/XRCC6 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
CXCR5 (NM_032966) Human Tagged Lenti ORF Clone
RC210737L3 10 µg

CXCR5 (NM_032966) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC26A6 (NM_134426) Human 3' UTR Clone
SC203626 10 µg

SLC26A6 (NM_134426) Human 3' UTR Clone

Sign In for Pricing
View Details
Lentiviral human RRP12 shRNA (UAS) - Lentiviral human RRP12 shRNA (UAS, iRFP) (100)
GTR15113595 1 Vial

Lentiviral human RRP12 shRNA (UAS) - Lentiviral human RRP12 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
TRIM28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
47762111 3x 1.0 µg

TRIM28 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
F2rl3 (NM_007975) Mouse Tagged Lenti ORF Clone
MR223298L3 10 µg

F2rl3 (NM_007975) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details