What is the catalog number for MEIS3 Antibody - middle region?

The catalog number for MEIS3 Antibody - middle region is ARP47649_P050-25UL.

What sizes are available for MEIS3 Antibody - middle region?

MEIS3 Antibody - middle region is available in the following size(s): 25 µL.

Is MEIS3 Antibody - middle region in stock?

MEIS3 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

MEIS3 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Meis homeobox 3

Gene Aliases

MRG2

Gene ID

56917

Swiss Prot

Q99687-3

Accession Number

NP_001009813

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human MEIS3

Target

MEIS3 belongs to the TALE/MEIS homeobox family. It contains 1 homeobox DNA-binding domain. The function of the MEIS3 protein remains unknown.

Partner Proteins

HOXA13

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FPKVATNIMRAWLFQHLSHPYPSEEQKKQLAQDTGLTILQVNNWFINARR

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol