Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PA2G4 Antibody - N-terminal region (ARP47603_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Proliferation-associated 2G4

Gene Aliases

EBP1, HG4-1, p38-2G4

Gene ID

5036

Swiss Prot

Q9UQ80

Accession Number

NP_006182.2

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N-terminal region of human PA2G4

Target

This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional co-repressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases. This protein has been implicated in growth inhibition and the induction of differentiation of human cancer cells. Six pseudogenes, located on chromosomes 3, 6, 9, 18, 20 and X, have been identified.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

GEDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKG

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

31kDa

Protein Length

284

NCBI Gene Symbol

PA2G4

Host or Source

Rabbit

Protein Name

Proliferation-associated protein 2G4

Gene Name URL

PA2G4

Nucleotide Accession Number

NM_006191.2

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Vibrio Cholerae VCM66_0205 Protein (aa 1-224)
VAng-Cr2788-500gEcoli 500 µg (E. coli)

Recombinant Vibrio Cholerae VCM66_0205 Protein (aa 1-224)

Sign In for Pricing
View Details
InVivoMAb Anti-Influenza A virus HA/Hemagglutinin Antibody (Iv0150)
MBS1570188-01 0.1 mg

InVivoMAb Anti-Influenza A virus HA/Hemagglutinin Antibody (Iv0150)

Sign In for Pricing
View Details
InVivoMAb Anti-Influenza A virus HA/Hemagglutinin Antibody (Iv0150)
MBS1570188-02 1 mg

InVivoMAb Anti-Influenza A virus HA/Hemagglutinin Antibody (Iv0150)

Sign In for Pricing
View Details
InVivoMAb Anti-Influenza A virus HA/Hemagglutinin Antibody (Iv0150)
MBS1570188-03 5x 1 mg

InVivoMAb Anti-Influenza A virus HA/Hemagglutinin Antibody (Iv0150)

Sign In for Pricing
View Details
Chicken sIgA (Secretory Immunoglobulin A) ELISA Kit
ECH0138 96 Tests

Chicken sIgA (Secretory Immunoglobulin A) ELISA Kit

Sign In for Pricing
View Details
APC_Cy7-Linked Polyclonal Antibody to Isthmin 1 (ISM1)
MBS2164128-01 0.1 mL

APC_Cy7-Linked Polyclonal Antibody to Isthmin 1 (ISM1)

Sign In for Pricing
View Details