Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SAC antibody - N-terminal region (ARP47447_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Adenylate cyclase 10 (soluble)

Gene Aliases

SAC, HCA2, SACI, Sacy, hsAC, HEL-S-7a

Gene ID

55811

Swiss Prot

Q96PN6

Accession Number

NP_060887

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SAC

Target

SAC belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction.The protein encoded by this gene belongs to a distinct class of mammalian adenylyl cyclase that is soluble and insensitive to G protein or forskolin regulation. It is localized in the cytoplasm and is thought to function as a general bicarbonate sensor throughout the body. It may also play an important role in the generation of cAMP in spermatozoa, implying possible roles in sperm maturation through the epididymis, capacitation, hypermotility, and/or the acrosome reaction. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

PTGIR; SSTR5

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VGHTVRHEYTVIGQKVNLAARMMMYYPGIVTCDSVTYNGSNLPAYFFKEL

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 93%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

187kDa

Protein Length

1610

NCBI Gene Symbol

ADCY10

Host or Source

Rabbit

Protein Name

Adenylate cyclase type 10

Gene Name URL

ADCY10

Nucleotide Accession Number

NM_018417

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin VII Antibody
R31187 100 µg

Annexin VII Antibody

Sign In for Pricing
View Details
pLV3-U6-TRIM32-shRNA3-CopGFP-Puro Plasmid
PVT62309 2 µg

pLV3-U6-TRIM32-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
PIK3R5 (NM_014308) Human Tagged ORF Clone Lentiviral Particle
RC222249L2V 200 µL

PIK3R5 (NM_014308) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
SMYD3 Rabbit Polyclonal Antibody
E28PN6181 100 µL

SMYD3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TMEM109 Human siRNA Oligo Duplex (Locus ID 79073)
SR324953 1 Kit

TMEM109 Human siRNA Oligo Duplex (Locus ID 79073)

Sign In for Pricing
View Details
Kinesis Adapter Male Luer to Male 1/4-28; PP
CHR4245 1 Each

Kinesis Adapter Male Luer to Male 1/4-28; PP

Sign In for Pricing
View Details