What is the catalog number for Lpcat2 Antibody - C-terminal region?

The catalog number for Lpcat2 Antibody - C-terminal region is ARP47359_P050-25UL.

What sizes are available for Lpcat2 Antibody - C-terminal region?

Lpcat2 Antibody - C-terminal region is available in the following size(s): 25 µL.

Is Lpcat2 Antibody - C-terminal region in stock?

Lpcat2 Antibody - C-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can I request a Safety Data Sheet (SDS) for this product?

Yes, safety data sheets are available for hazardous or chemically classified products and can be provided on request or downloaded from the product page.

Can this product be used for co-immunoprecipitation (Co-IP)?

Suitability for Co-IP depends on the specific antibody and is noted under validated applications on the datasheet. If it isn’t listed, contact our technical support team for guidance based on your target and sample type.

Is this kit compatible with automated liquid handling platforms?

Automation compatibility varies by kit and isn’t always listed on the datasheet. Contact our technical support team with details of your platform so we can confirm with the manufacturer.

Lpcat2 Antibody - C-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Lysophosphatidylcholine acyltransferase 2

Gene Aliases

Ayt, LPC, Aytl1, Aytl1a, lpafat1, lysoPAFAT, 1-AGPAT 11, A330042H22, lysoPAFAT/LPCAT2

Gene ID

270084

Swiss Prot

Q8BYI6

Accession Number

NP_766602

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Zebrafish

Target

Lpcat2 possesses both acyltransferase and acetyltransferase activities. Activity is calcium-dependent. It is involved in platelet-activating factor (PAF) biosynthesis by catalyzing the conversion of the PAF precursor, 1-O-alkyl-sn-glycero-3-phosphocholine (lyso-PAF) into 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine (PAF) . It also converts lyso-PAF to 1-alkyl-phosphatidylcholine (PC), a major component of cell membranes and a PAF precursor. Under resting conditions, acyltransferase activity is preferred. Upon acute inflammatory stimulus, acetyltransferase activity is enhanced and PAF synthesis increases.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LGVPDLNVSGLFREIAQRDSVSYEEFKSFALKHPEYAKIFTTYLDLQTCH

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol