Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PCDH12 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Protocadherin 12

Gene Aliases

DMJDS1, VECAD2, VE-cadherin-2

Gene ID

51294

Swiss Prot

Q9NPG4

Accession Number

NP_057664

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human PCDH12

Target

PCDH12 belongs to the protocadherin protein family, a subfamily of the cadherin superfamily. It consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.This gene belongs to the protocadherin gene family, a subfamily of the cadherin superfamily. The encoded protein consists of an extracellular domain containing 6 cadherin repeats, a transmembrane domain and a cytoplasmic tail that differs from those of the classical cadherins. The gene localizes to the region on chromosome 5 where the protocadherin gene clusters reside. The exon organization of this transcript is similar to that of the gene cluster transcripts, notably the first large exon, but no significant sequence homology exists. The function of this cellular adhesion protein is undetermined but mouse protocadherin 12 does not bind catenins and appears to have no affect on cell migration or growth.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SSRPFLLTTIVARDADSGANGEPLYSIRSGNEAHLFILNPHTGQLFVNVT

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 85%; Dog: 92%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Pig: 92%; Rat: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

126kDa

Protein Length

1184

NCBI Gene Symbol

PCDH12

Host or Source

Rabbit

Protein Name

Protocadherin-12

Gene Name URL

PCDH12

Nucleotide Accession Number

NM_016580

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse/Rat Neuroglycan C/CSPG5 Affinity Purified PAb
AF5665 100 µg

Mouse/Rat Neuroglycan C/CSPG5 Affinity Purified PAb

Sign In for Pricing
View Details
GRM8 Antibody
A48378-100UL 100 µL

GRM8 Antibody

Sign In for Pricing
View Details
TNS4 Rabbit mAb
RDSA68133 100 µL

TNS4 Rabbit mAb

Sign In for Pricing
View Details
Mouse Anti-Human CD261 Monoclonal Antibody, Azide Free Clone B-T35
MBS335292-01 0.2 mg

Mouse Anti-Human CD261 Monoclonal Antibody, Azide Free Clone B-T35

Sign In for Pricing
View Details
Mouse Anti-Human CD261 Monoclonal Antibody, Azide Free Clone B-T35
MBS335292-02 0.5 mg

Mouse Anti-Human CD261 Monoclonal Antibody, Azide Free Clone B-T35

Sign In for Pricing
View Details
Mouse Anti-Human CD261 Monoclonal Antibody, Azide Free Clone B-T35
MBS335292-03 5x 0.5 mg

Mouse Anti-Human CD261 Monoclonal Antibody, Azide Free Clone B-T35

Sign In for Pricing
View Details