Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHCR24 antibody - N-terminal region (ARP47072_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

24-dehydrocholesterol reductase

Gene Aliases

DCE, SELADIN1, Nbla03646, seladin-1

Gene ID

1718

Swiss Prot

Q15392

Accession Number

NP_055577

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human DHCR24

Target

DHCR24 is a flavin adenine dinucleotide (FAD) -dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells.This gene encodes a flavin adenine dinucleotide (FAD) -dependent oxidoreductase which catalyzes the reduction of the delta-24 double bond of sterol intermediates during cholesterol biosynthesis. The protein contains a leader sequence that directs it to the endoplasmic reticulum membrane. Missense mutations in this gene have been associated with desmosterolosis. Also, reduced expression of the gene occurs in the temporal cortex of Alzheimer disease patients and overexpression has been observed in adrenal gland cancer cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

UBC; env; UBL4A; TP53; MDM2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

FLLPLSLIFDIYYYVRAWVVFKLSSAPRLHEQRVRDIQKQVREWKEQGSK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 93%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

58kDa

Protein Length

516

NCBI Gene Symbol

DHCR24

Host or Source

Rabbit

Protein Name

Delta (24) -sterol reductase

Gene Name URL

DHCR24

Nucleotide Accession Number

NM_014762

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine CTXI (Cross Linked C-telopeptide of Type I Collagen) ELISA Kit
EKE63334 96 Tests

Porcine CTXI (Cross Linked C-telopeptide of Type I Collagen) ELISA Kit

Sign In for Pricing
View Details
Mouse Monoclonal Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (AT13E10) [Alexa Fluor 532]
NBP2-61163AF532 0.1 mL

Mouse Monoclonal Cytosolic Sulfotransferase 2A1/SULT2A1 Antibody (AT13E10) [Alexa Fluor 532]

Sign In for Pricing
View Details
FUBP3 Antibody
MBS9216165-01 0.1 mL

FUBP3 Antibody

Sign In for Pricing
View Details
FUBP3 Antibody
MBS9216165-02 5x 0.1 mL

FUBP3 Antibody

Sign In for Pricing
View Details
ISP Medium No. 1 (Tryptone Yeast Extract Broth)
RDM-ISP-01 500 g

ISP Medium No. 1 (Tryptone Yeast Extract Broth)

Sign In for Pricing
View Details
pCMV-SPORT6-NCR1 Plasmid
PVT22318 2 µg

pCMV-SPORT6-NCR1 Plasmid

Sign In for Pricing
View Details