Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NOX1 Antibody - C-terminal region

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

NADPH oxidase 1

Gene Aliases

MOX1, NOH1, NOH-1, GP91-2

Gene ID

27035

Swiss Prot

Q9Y5S8

Accession Number

NP_008983

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human NOX1

Target

Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox.Voltage-gated proton (hydrogen) channels play an important role in cellular defense against acidic stress. They are unique among ion channels with respect to their extremely high selectivity, marked temperature dependence, and unitary conductance, which is 3 orders of magnitude lower than that of most other ion channels. NOX1 is a homolog of the catalytic subunit of the superoxide-generating NADPH oxidase of phagocytes, gp91phox. Three splice variants of NOX1 have been identified, NOH-1L, NOH-1S and NOH-1Lv. The NOH-1S currents were reversibly blocked by zinc, a known H+ channel inhibitor. The NOH-1S variant does not contain an electron transport chain and it is thought that H+ conductance is its main physiologic function, whereas NOH-1L may conduct H+ ions as part of its electron transport mechanism.

Partner Proteins

NOXA1; CYBA

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

STIATSHPKSVVGVFLCGPRTLAKSLRKCCHRYSSLDPRKVQFYFNKENF

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

65 kDa

Protein Length

564

NCBI Gene Symbol

NOX1

Host or Source

Rabbit

Protein Name

NADPH oxidase 1

Gene Name URL

NOX1

Nucleotide Accession Number

NM_007052

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal BMP-1/PCP Antibody (OTI3E9) [HRP]
NBP2-70255H 0.1 mL

Mouse Monoclonal BMP-1/PCP Antibody (OTI3E9) [HRP]

Sign In for Pricing
View Details
EPHB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0687408 1.0 µg DNA

EPHB4 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2119417-01 0.1 mL

APC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2119417-02 0.2 mL

APC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2119417-03 0.5 mL

APC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details
APC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)
MBS2119417-04 1 mL

APC-Linked Monoclonal Antibody to Nerve Growth Factor (NGF)

Sign In for Pricing
View Details