Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HS3ST3B1 antibody - N-terminal region (ARP46685_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Heparan sulfate (glucosamine) 3-O-sulfotransferase 3B1

Gene Aliases

3OST3B1, 3-OST-3B, h3-OST-3B

Gene ID

9953

Swiss Prot

Q9Y662

Accession Number

NP_006032

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human HS3ST3B1

Target

HS3ST3B1 is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. The enzyme encoded by this gene is a member of the heparan sulfate biosynthetic enzyme family. It is a type II integral membrane protein and possesses heparan sulfate glucosaminyl 3-O-sulfotransferase activity. The sulfotransferase domain of this enzyme is highly similar to the same domain of heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1, and these two enzymes sulfate an identical disaccharide. This gene is widely expressed, with the most abundant expression in liver and placenta.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

AMLCVWLYMFLYSCAGSCAAAPGLLLLGSGSRAAHDPPALATAPDGTPPR

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 92%; Dog: 93%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Pig: 93%; Rabbit: 87%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

43kDa

Protein Length

390

NCBI Gene Symbol

HS3ST3B1

Host or Source

Rabbit

Protein Name

Heparan sulfate glucosamine 3-O-sulfotransferase 3B1

Gene Name URL

HS3ST3B1

Nucleotide Accession Number

NM_006041

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cluster Of Differentiation 14 (CD14) Magnetic Fluorescence Assay Kit
MBS2156091-01 96 Tests

Cluster Of Differentiation 14 (CD14) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cluster Of Differentiation 14 (CD14) Magnetic Fluorescence Assay Kit
MBS2156091-02 5x 96 Tests

Cluster Of Differentiation 14 (CD14) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Cluster Of Differentiation 14 (CD14) Magnetic Fluorescence Assay Kit
MBS2156091-03 10x 96 Tests

Cluster Of Differentiation 14 (CD14) Magnetic Fluorescence Assay Kit

Sign In for Pricing
View Details
Rabbit Polyclonal SIPA1 Antibody
NBP2-20369 0.1 mL

Rabbit Polyclonal SIPA1 Antibody

Sign In for Pricing
View Details
Map3k10 ORF Vector (Mouse) (pORF)
ORF049736 1.0 µg DNA

Map3k10 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
ZNF23 Polyclonal Antibody
RD88168A-01 60 μL

ZNF23 Polyclonal Antibody

Sign In for Pricing
View Details