Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MMP16 antibody - N-terminal region (ARP46674_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Matrix metallopeptidase 16 (membrane-inserted)

Gene Aliases

MMP-X2, C8orf57, MT-MMP2, MT-MMP3, MT3-MMP

Gene ID

4325

Swiss Prot

P51512

Accession Number

NP_005932

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MMP16

Target

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another soluble form of the protein. Both forms of the protein activate MMP2 by cleavage.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene produces at least two transcripts, one which encodes a membrane-bound form and another a soluble form of the protein. Both forms of the protein activate MMP2 by cleavage. This gene was once referred to as MT-MMP2, but was renamed as MT-MMP3 or MMP16.

Partner Proteins

KISS1; LRP1; ERBB2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ALAAMQQFYGINMTGKVDRNTIDWMKKPRCGVPDQTRGSSKFHIRRKRYA

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

56kDa

Protein Length

607

NCBI Gene Symbol

MMP16

Host or Source

Rabbit

Protein Name

Matrix metalloproteinase-16

Gene Name URL

MMP16

Nucleotide Accession Number

NM_005941

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A2 (ANXA2) Antibody
abx318287-01 20 µg

Annexin A2 (ANXA2) Antibody

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody
abx318287-02 50 µg

Annexin A2 (ANXA2) Antibody

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody
abx318287-03 100 µg

Annexin A2 (ANXA2) Antibody

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody
abx318287-04 200 µg

Annexin A2 (ANXA2) Antibody

Sign In for Pricing
View Details
Annexin A2 (ANXA2) Antibody
abx318287-05 1 mg

Annexin A2 (ANXA2) Antibody

Sign In for Pricing
View Details
Mannose 6 Phosphate Receptor, Cation-independent (MPR, 300kD Mannose 6 Phosphate Receptor, Cation Independent Mannose 6 Phosphate Receptor, CI Man-6-P Receptor, CI-MPR, CIMPR, CD222, Insulin-like Growth Factor 2 Receptor, IGF2 Receptor, IGF2R, Insulin-like Growth Factor II Receptor, IGF-II Receptor, M6PR, M6P/IGF2 Receptor, M6P/IGF2R, MPR300, MPRI)
M2255-16 100 µg

Mannose 6 Phosphate Receptor, Cation-independent (MPR, 300kD Mannose 6 Phosphate Receptor, Cation Independent Mannose 6 Phosphate Receptor, CI Man-6-P Receptor, CI-MPR, CIMPR, CD222, Insulin-like Growth Factor 2 Receptor, IGF2 Receptor, IGF2R, Insulin-like Growth Factor II Receptor, IGF-II Receptor, M6PR, M6P/IGF2 Receptor, M6P/IGF2R, MPR300, MPRI)

Sign In for Pricing
View Details