Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FXYD1 antibody - N-terminal region (ARP46562_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

FXYD domain containing ion transport regulator 1

Gene Aliases

PLM

Gene ID

5348

Swiss Prot

O00168

Accession Number

NP_005022

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FXYD1

Target

FXYD1 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel) . FXYD2, also known as the gamma subunit of the Na, K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The protein is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase. It is thought to form an ion channel or regulate ion channel activity. Transcript variants with different 5' UTR sequences have been described in the literature.This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. Mouse FXYD5 has been termed RIC (Related to Ion Channel) . FXYD2, also known as the gamma subunit of the Na, K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. The protein encoded by this gene is a plasma membrane substrate for several kinases, including protein kinase A, protein kinase C, NIMA kinase, and myotonic dystrophy kinase. It is thought to form an ion channel or regulate ion channel activity. Transcript variants with different 5' UTR sequences have been described in the literature.

Partner Proteins

PPP1CA; PPAP2A; DMPK; PRKACA; ATP1B1; ATP1A1; YWHAQ

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

ASLGHILVFCVGLLTMAKAESPKEHDPFTYDYQSLQIGGLVIAGILFILG

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 86%; Guinea Pig: 85%; Horse: 86%; Human: 100%; Pig: 86%; Rabbit: 79%; Rat: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

10kDa

Protein Length

92

NCBI Gene Symbol

FXYD1

Host or Source

Rabbit

Protein Name

Phospholemman

Gene Name URL

FXYD1

Nucleotide Accession Number

NM_005031

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF434 Antibody
GWB-MM238D 50 µg

ZNF434 Antibody

Sign In for Pricing
View Details
CPA1 Protein Vector (Mouse) (pPB-C-His)
PV167590 500 ng

CPA1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Brilliant blue G
GRM1219-25G 1 unit

Brilliant blue G

Sign In for Pricing
View Details
VEGFR2, CT (KDR, FLK1, KDR, VEGFR2, Vascular endothelial growth factor receptor 2, Fetal liver kinase 1, Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1) (PE) discontinued
043746-PE 200 µL

VEGFR2, CT (KDR, FLK1, KDR, VEGFR2, Vascular endothelial growth factor receptor 2, Fetal liver kinase 1, Kinase insert domain receptor, Protein-tyrosine kinase receptor flk-1) (PE) discontinued

Sign In for Pricing
View Details
Mouse Monoclonal IL-12 p70/IL-12A Antibody (OTI2A8) [Biotin]
NBP2-71031B 0.1 mL

Mouse Monoclonal IL-12 p70/IL-12A Antibody (OTI2A8) [Biotin]

Sign In for Pricing
View Details
Vertical Autoclave
LX712VA 1 Unit

Vertical Autoclave

Sign In for Pricing
View Details