What is the catalog number for Chst2 Antibody - middle region?

The catalog number for Chst2 Antibody - middle region is ARP46422_P050-25UL.

What sizes are available for Chst2 Antibody - middle region?

Chst2 Antibody - middle region is available in the following size(s): 25 µL.

Is Chst2 Antibody - middle region in stock?

Chst2 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is this product species cross-reactive?

Cross-reactivity data, based on available testing, is listed under the reactivity section of the datasheet. Contact us if you need reactivity confirmed for a species not listed.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Chst2 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Carbohydrate sulfotransferase 2

Gene Aliases

Gn6, GST-, Chts2, GST-2, Gn6st, AI428561, AW121776, GlcNAc6ST, C130041E03Rik

Gene ID

54371

Swiss Prot

Q80WV3

Accession Number

NP_061233

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Target

Chst2 catalyzes the transfer of sulfate to position 6 of non-reducing N-acetylglucosamine (GlcNAc) residues within keratan-like structures on N-linked glycans and within mucin-associated glycans that can ultimately serve as L-selectin ligands. L-selectin ligands are present in high endothelial cells (HEVs) and play a central role in lymphocyte homing at sites of inflammation. Chst2 participates in biosynthesis of L-selectin ligand sialyl 6-sulfo Lewis X and in lymphocyte homing to Peyer patches. It has no activity toward O-linked sugars. Its substrate specificity may be influenced by its subcellular location. It sulfates GlcNAc residues at terminal, non-reducing ends of oligosaccharide chains.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

VFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRV

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol