Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MRPS12 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Mitochondrial ribosomal protein S12

Gene Aliases

RPS12, RPMS12, RPSM12, MPR-S12, MT-RPS12

Gene ID

6183

Swiss Prot

O15235

Accession Number

NP_066930

Reactivity

Human, Rat, Cow, Dog, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human MRPS12

Target

Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. MRPS12 is the 28S subunit protein that belongs to the ribosomal protein S12P family. The protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics.Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes, where this ratio is reversed. Another difference between mammalian mitoribosomes and prokaryotic ribosomes is that the latter contain a 5S rRNA. Among different species, the proteins comprising the mitoribosome differ greatly in sequence, and sometimes in biochemical properties, which prevents easy recognition by sequence homology. This gene encodes a 28S subunit protein that belongs to the ribosomal protein S12P family. The encoded protein is a key component of the ribosomal small subunit and controls the decoding fidelity and susceptibility to aminoglycoside antibiotics. The gene for mitochondrial seryl-tRNA synthetase is located upstream and adjacent to this gene, and both genes are possible candidates for the autosomal dominant deafness gene (DFNA4) . Splice variants that differ in the 5' UTR have been found for this gene; all three variants encode the same protein.

Partner Proteins

UBC; LRIF1; SPINK7; C14orf1; UNC119; CRMP1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LVPRLWATCSMATLNQMHRLGPPKRPPRKLGPTEGRPQLKGVVLCTFTRK

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 86%; Dog: 91%; Guinea Pig: 86%; Horse: 79%; Human: 100%; Rat: 86%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

12kDa

Protein Length

138

NCBI Gene Symbol

MRPS12

Host or Source

Rabbit

Protein Name

28S ribosomal protein S12, mitochondrial

Gene Name URL

MRPS12

Nucleotide Accession Number

NM_021107

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

Monkey Connective Tissue-Activating Peptide III ELISA Kit
MBS033077-01 48 Well

Monkey Connective Tissue-Activating Peptide III ELISA Kit

Ask
View Details
Monkey Connective Tissue-Activating Peptide III ELISA Kit
MBS033077-02 96 Well

Monkey Connective Tissue-Activating Peptide III ELISA Kit

Ask
View Details
Monkey Connective Tissue-Activating Peptide III ELISA Kit
MBS033077-03 5x 96 Well

Monkey Connective Tissue-Activating Peptide III ELISA Kit

Ask
View Details
Monkey Connective Tissue-Activating Peptide III ELISA Kit
MBS033077-04 10x 96 Well

Monkey Connective Tissue-Activating Peptide III ELISA Kit

Ask
View Details
Lentiviral human LAMB1 sgRNA gene knockout kit - Lentiviral human LAMB1 sgRNA gene knockout kit (25)
GTR15390612 1 Vial

Lentiviral human LAMB1 sgRNA gene knockout kit - Lentiviral human LAMB1 sgRNA gene knockout kit (25)

Ask
View Details
Influenza A H1N1 (A/Puerto Rico/8/34/Mount Sinai) Nucleoprotein/NP (I116M) Protein (ECD, His Tag)
MBS8124062-01 0.1 mg

Influenza A H1N1 (A/Puerto Rico/8/34/Mount Sinai) Nucleoprotein/NP (I116M) Protein (ECD, His Tag)

Ask
View Details