What is the catalog number for St8sia1 Antibody - middle region?

The catalog number for St8sia1 Antibody - middle region is ARP45414_P050-25UL.

What sizes are available for St8sia1 Antibody - middle region?

St8sia1 Antibody - middle region is available in the following size(s): 25 µL.

Is St8sia1 Antibody - middle region in stock?

St8sia1 Antibody - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

What temperature does this product ship at?

Shipping temperature is chosen based on the product’s stability needs, ranging from ambient to dry ice, and is indicated on the product page. Any related shipping fee is shown clearly in your quotation.

What is the molecular weight of the target protein?

Molecular weight information, where applicable, is listed on the datasheet under target details, useful for confirming the correct band on western blot.

St8sia1 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Aliases

Siat8, Siat8a

Gene ID

25280

Swiss Prot

G3V7T2

Accession Number

NP_036945

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of Rat St8sia1

Target

St8sia1 is an alpha-2,8-sialyltransferase that catalyzes the biosynthesis of GT1a and GQ1b as well as GD3.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NPNFLRNIGKFWKGRGIHAKRLSTGLFLVSAALGLCEEVSIYGFWPFSVN

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol