Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FMO4 antibody - N-terminal region (ARP45209_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Flavin containing monooxygenase 4

Gene Aliases

FMO2

Gene ID

2329

Swiss Prot

P31512

Accession Number

NP_002013

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human FMO4

Target

FMO4 belongs to the FMO family. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics. Metabolic N-oxidation of the diet-derived amino-trimethylamine (TMA) is mediated by flavin-containing monooxygenase and is subject to an inherited FMO3 polymorphism in man resulting in a small subpopulation with reduced TMA N-oxidation capacity resulting in fish odor syndrome Trimethylaminuria. Three forms of the enzyme, FMO1 found in fetal liver, FMO2 found in adult liver, and FMO3 are encoded by genes clustered in the 1q23-q25 region. Flavin-containing monooxygenases are NADPH-dependent flavoenzymes that catalyzes the oxidation of soft nucleophilic heteroatom centers in drugs, pesticides, and xenobiotics.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MVCTGHFLNPHLPLEAFPGIHKFKGQILHSQEYKIPEGFQGKRVLVIGLG

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 85%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

63kDa

Protein Length

558

NCBI Gene Symbol

FMO4

Host or Source

Rabbit

Protein Name

Dimethylaniline monooxygenase [N-oxide-forming] 4

Gene Name URL

FMO4

Nucleotide Accession Number

NM_002022

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLR9 (Toll-like Receptor 9, CD289) (Biotin)
MBS6171481-01 0.1 mL

TLR9 (Toll-like Receptor 9, CD289) (Biotin)

Sign In for Pricing
View Details
TLR9 (Toll-like Receptor 9, CD289) (Biotin)
MBS6171481-02 5x 0.1 mL

TLR9 (Toll-like Receptor 9, CD289) (Biotin)

Sign In for Pricing
View Details
14-3-3 ζ Polyclonal Antibody
RA21460-01 50 µL

14-3-3 ζ Polyclonal Antibody

Sign In for Pricing
View Details
14-3-3 ζ Polyclonal Antibody
RA21460-02 100 µL

14-3-3 ζ Polyclonal Antibody

Sign In for Pricing
View Details
TMCO6 CRISPR Knock Out 293T Cell Line (Human)
46834141 1x 10^6 Cells / 1.0 mL

TMCO6 CRISPR Knock Out 293T Cell Line (Human)

Sign In for Pricing
View Details
HIST1H2BB (Ab-5) Antibody
MBS7106689-01 0.05 mL

HIST1H2BB (Ab-5) Antibody

Sign In for Pricing
View Details