Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDH8 Antibody - middle region

Product Specifications

CAS Number

9007-83-4

Gene Name

Cadherin 8, type 2

Gene Aliases

Nbla04261

Gene ID

1006

Swiss Prot

P55286

Accession Number

NP_001787

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human CDH8

Target

CDH8 is a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the protein's homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed in brain and is putatively involved in synaptic adhesion, axon outgrowth and guidance.This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane-spanning domain, and a small, highly conserved C-terminal cytoplasmic domain. The extracellular domain consists of 5 subdomains, each containing a cadherin motif, and appears to determine the specificity of the protein's homophilic cell adhesion activity. Type II (atypical) cadherins are defined based on their lack of a HAV cell adhesion recognition sequence specific to type I cadherins. This particular cadherin is expressed in brain and is putatively involved in synaptic adhesion, axon outgrowth and guidance.

Partner Proteins

CTNNB1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HENAALNSVIGQVTARDPDITSSPIRFSIDRHTDLERQFNINADDGKITL

Applications

WB, IHC

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

81kDa

Protein Length

799

NCBI Gene Symbol

CDH8

Host or Source

Rabbit

Protein Name

Cadherin-8

Gene Name URL

CDH8

Nucleotide Accession Number

NM_001796

More Discoveries

Explore Other Products

Browse additional items from our catalog

GABPB2 (GABPB1) Mouse Monoclonal Antibody [Clone ID: LBI4D7]
AMM20152VCF 100 µg

GABPB2 (GABPB1) Mouse Monoclonal Antibody [Clone ID: LBI4D7]

Sign In for Pricing
View Details
DPYSL5 Recombinant Antibody, PerCP Conjugated
bsm-62164R-PerCP 100 µL

DPYSL5 Recombinant Antibody, PerCP Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Ssxb2 shRNA (UAS) - Lentiviral mouse Ssxb2 shRNA (UAS, RFP) plasmid
GTR15173857 1 Vial

Lentiviral mouse Ssxb2 shRNA (UAS) - Lentiviral mouse Ssxb2 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Rabbit Monoclonal Progesterone R/NR3C3 Antibody (PGR/8099R) [Janelia Fluor 585]
NBP3-24086JF585 0.1 mL

Rabbit Monoclonal Progesterone R/NR3C3 Antibody (PGR/8099R) [Janelia Fluor 585]

Sign In for Pricing
View Details
Recombinant Human ENO1 / Alpha-Enolase 1, Animal Free & Carrier Free
C-CYP393-20ug 20 µg

Recombinant Human ENO1 / Alpha-Enolase 1, Animal Free & Carrier Free

Sign In for Pricing
View Details
PRNP AAV Vector (Human) (CMV)
37724101 1 µg

PRNP AAV Vector (Human) (CMV)

Sign In for Pricing
View Details