What is the catalog number for ROM1 antibody - middle region (ARP44260_P050)?

The catalog number for ROM1 antibody - middle region (ARP44260_P050) is ARP44260_P050.

What sizes are available for ROM1 antibody - middle region (ARP44260_P050)?

ROM1 antibody - middle region (ARP44260_P050) is available in the following size(s): 100 µL.

Is ROM1 antibody - middle region (ARP44260_P050) in stock?

ROM1 antibody - middle region (ARP44260_P050) is currently made to order / not held in immediate stock. Contact us for lead time.

Does this product need any special customs documentation to be imported to my country?

If you’re outside the EU, UK, or USA, you’re responsible for customs clearance and any related taxes or fees. We provide the standard import documents, such as the Commercial Invoice, Packing List, and Airway Bill, in advance, so let us know early if your customs office needs anything additional for this specific product.

What buffer is this product supplied in?

The formulation or storage buffer is listed on the product datasheet. If you require a carrier-free or custom formulation, contact us before ordering, as this may involve a made-to-order production timeline.

What dilution range is recommended for immunohistochemistry (IHC) with this antibody?

A starting IHC dilution range is listed on the datasheet, but should be optimized for your specific tissue type and staining protocol.

ROM1 antibody - middle region (ARP44260_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Retinal outer segment membrane protein 1

Gene Aliases

ROM, RP7, ROSP1, TSPAN23

Gene ID

6094

Swiss Prot

Q03395

Accession Number

NP_000318

Reactivity

Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the middle region of human ROM1

Target

ROM1 is an integral membrane protein found in the photoreceptor disk rim of the eye. It can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS) . It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa.This gene is a member of a photoreceptor-specific gene family and encodes an integral membrane protein found in the photoreceptor disk rim of the eye. This protein can form homodimers or can heterodimerize with another photoreceptor, retinal degeneration slow (RDS) . It is essential for disk morphogenesis, and may also function as an adhesion molecule involved in the stabilization and compaction of outer segment disks or in the maintenance of the curvature of the rim. Certain defects in this gene have been associated with the degenerative eye disease retinitis pigmentosa. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Partner Proteins

PHGDH; PRPH2

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

NPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGT

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 92%; Dog: 92%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

37kDa

Protein Length

351

NCBI Gene Symbol

ROM1

Host or Source

Rabbit

Protein Name

Rod outer segment membrane protein 1

Gene Name URL