Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC9A7 antibody - N-terminal region (ARP44066_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.//here

Product Specifications

CAS Number

9007-83-4

Gene Name

Solute carrier family 9, subfamily A (NHE7, cation proton antiporter 7), member 7

Gene Aliases

NHE7, NHE-7, MRX108, SLC9A6

Gene ID

84679

Swiss Prot

Q96T83

Accession Number

NP_115980

Reactivity

Human, Mouse, Dog, Goat, Guinea Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human SLC9A7

Target

Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. It may play an important role in maintaining cation homeostasis and function of the trans-Golgi network.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.Organelles of the secretory and endocytic pathways are distinguished by their luminal acidity, which is generated by the activity of an electrogenic vacuolar-type hydrogen ATPase. Progressive acidification of vesicles in the endocytic pathway is essential for the redistribution and degradation of internalized membrane proteins, such as ligand receptor complexes and fluid-phase solutes. This gene is expressed predominantly in the trans-Golgi network, and mediates the influx of sodium or potassium in exchange for hydrogen. It may thus play an important role in maintaining cation homeostasis and function of the trans-Golgi network. This gene is part of a gene cluster on chromosome Xp11.23.

Partner Proteins

UBC; SCAMP5; SCAMP2; SCAMP1; SLC9A7

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

LGWGLRVAAAASASSSGAAAEDSSAMEELATEKEAEESHRQDSVSLLTFI

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Dog: 100%; Goat: 85%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Zebrafish: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

80kDa

Protein Length

725

NCBI Gene Symbol

SLC9A7

Host or Source

Rabbit

Protein Name

Sodium/hydrogen exchanger 7

Gene Name URL

SLC9A7

Nucleotide Accession Number

NM_032591

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse PSME4 Protein, His (Fc)-Avi-tagged
PSME4-7229M 50 µg

Recombinant Mouse PSME4 Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
TBC1D13 Adenovirus (Mouse)
46229054 1.0 mL

TBC1D13 Adenovirus (Mouse)

Sign In for Pricing
View Details
mmu-miR-7213-3p miRNA Antagomir
MNM02996 2x 5.0 nmol

mmu-miR-7213-3p miRNA Antagomir

Sign In for Pricing
View Details
GABARAP Antibody
F46304-0.4ML 0.4 mL

GABARAP Antibody

Sign In for Pricing
View Details
MAGEB4 Mouse Monoclonal Antibody [Clone ID: LBI3A2]
AMM18822VCF 100 µg

MAGEB4 Mouse Monoclonal Antibody [Clone ID: LBI3A2]

Sign In for Pricing
View Details
Lentiviral mouse Gabrb1 shRNA (UAS) - Lentiviral mouse Gabrb1 shRNA (UAS, RFP) (25)
GTR15190055 1 Vial

Lentiviral mouse Gabrb1 shRNA (UAS) - Lentiviral mouse Gabrb1 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details