Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ABCA5 antibody - C-terminal region (ARP43688_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

ATP-binding cassette, sub-family A (ABC1), member 5

Gene Aliases

HTC3, ABC13, EST90625

Gene ID

23461

Swiss Prot

Q8WWZ7

Accession Number

NP_061142

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Rabbit

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human ABCA5

Target

The membrane-associated protein ABCA5 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White) . ABCA5 is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intracellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, and White) . This encoded protein is a member of the ABC1 subfamily. Members of the ABC1 subfamily comprise the only major ABC subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other ABC1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described.

Partner Proteins

NR4A1; CYP2E1

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

HKEYDDKKDFLLSRKVKKVATKYISFCVKKGEILGLLGPNGAGKSTIINI

Applications

IHC, WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 79%; Dog: 86%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 86%; Rat: 93%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

186kDa

Protein Length

1642

NCBI Gene Symbol

ABCA5

Host or Source

Rabbit

Protein Name

ATP-binding cassette sub-family A member 5

Gene Name URL

ABCA5

Nucleotide Accession Number

NM_018672

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

CRISPLD2, NT (CRISPLD2, CRISP11, LCRISP2, Cysteine-rich secretory protein LCCL domain-containing 2, Cysteine-rich secretory protein 11, LCCL domain-containing cysteine-rich secretory protein 2) (APC) discontinued
034230-APC 200 µL

CRISPLD2, NT (CRISPLD2, CRISP11, LCRISP2, Cysteine-rich secretory protein LCCL domain-containing 2, Cysteine-rich secretory protein 11, LCCL domain-containing cysteine-rich secretory protein 2) (APC) discontinued

Ask
View Details
GAPDH Antibody, HRP conjugated
A22783-100UG 100 µg

GAPDH Antibody, HRP conjugated

Ask
View Details
IRE1p, CT (Inositol-Requiring Protein 1, IRE1 alpha, IRE1a, Endoplasmic Reticulum-to-Nucleus Signaling 1, ERN1, FLJ30999, MGC163277, MGC163279, Serine/Threonine Protein Kinase/Endoribonuclease IRE1) (AP)
MBS6483567-01 0.1 mL

IRE1p, CT (Inositol-Requiring Protein 1, IRE1 alpha, IRE1a, Endoplasmic Reticulum-to-Nucleus Signaling 1, ERN1, FLJ30999, MGC163277, MGC163279, Serine/Threonine Protein Kinase/Endoribonuclease IRE1) (AP)

Ask
View Details
IRE1p, CT (Inositol-Requiring Protein 1, IRE1 alpha, IRE1a, Endoplasmic Reticulum-to-Nucleus Signaling 1, ERN1, FLJ30999, MGC163277, MGC163279, Serine/Threonine Protein Kinase/Endoribonuclease IRE1) (AP)
MBS6483567-02 5x 0.1 mL

IRE1p, CT (Inositol-Requiring Protein 1, IRE1 alpha, IRE1a, Endoplasmic Reticulum-to-Nucleus Signaling 1, ERN1, FLJ30999, MGC163277, MGC163279, Serine/Threonine Protein Kinase/Endoribonuclease IRE1) (AP)

Ask
View Details
MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (MaxLight 490)
MBS6385066-01 0.1 mL

MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (MaxLight 490)

Ask
View Details
MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (MaxLight 490)
MBS6385066-02 5x 0.1 mL

MCC (Colorectal Mutant Cancer Protein, Protein MCC, Mutated In Colorectal Cancers, MCC1, FLJ38893, FLJ46755, DKFZp762O1615) (MaxLight 490)

Ask
View Details