Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CYP46A1 antibody - C-terminal region (ARP43670_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Cytochrome P450, family 46, subfamily A, polypeptide 1

Gene Aliases

CP46, CYP46

Gene ID

10858

Swiss Prot

Q9Y6A2

Accession Number

NP_006659

Reactivity

Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse

Immunogen

The immunogen is a synthetic peptide directed towards the C terminal region of human CYP46A1

Target

CYP46A1 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.This protein localizes to the endoplasmic reticulum and hydroxylates medium-chain fatty acids such as laurate and myristate.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This endoplasmic reticulum protein is expressed in the brain, where it converts cholesterol to 24S-hydroxycholesterol. While cholesterol cannot pass the blood-brain barrier, 24S-hydroxycholesterol can be secreted in the brain into the circulation to be returned to the liver for catabolism. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

YVMGRMDTYFEDPLTFNPDRFGPGAPKPRFTYFPFSLGHRSCIGQQFAQM

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

57 kDa

Protein Length

500

NCBI Gene Symbol

CYP46A1

Host or Source

Rabbit

Protein Name

Cholesterol 24-hydroxylase

Gene Name URL

CYP46A1

Nucleotide Accession Number

NM_006668

More Discoveries

Explore Other Products

Browse additional items from our catalog

Influenza HA (518-526)
HY-P1837 1 Each

Influenza HA (518-526)

Sign In for Pricing
View Details
Duck Nucleolar RNA Helicase 2 (DDX21) ELISA Kit
MBS9936274 Inquire

Duck Nucleolar RNA Helicase 2 (DDX21) ELISA Kit

Sign In for Pricing
View Details
Transducin-Like enhancer protein 3 (TLE3) Mouse ELISA Kit
H7582 96 Tests

Transducin-Like enhancer protein 3 (TLE3) Mouse ELISA Kit

Sign In for Pricing
View Details
EFEMP1, NT (EFEMP1, FBLN3, FBNL, EGF-containing fibulin-like extracellular matrix protein 1, Extracellular protein S1-5, Fibrillin-like protein, Fibulin-3) (AP) discontinued
034940-AP 200 µL

EFEMP1, NT (EFEMP1, FBLN3, FBNL, EGF-containing fibulin-like extracellular matrix protein 1, Extracellular protein S1-5, Fibrillin-like protein, Fibulin-3) (AP) discontinued

Sign In for Pricing
View Details
M-CSF Receptor (phospho-Tyr546) rabbit pAb
ES14991-01 50 µL

M-CSF Receptor (phospho-Tyr546) rabbit pAb

Sign In for Pricing
View Details
M-CSF Receptor (phospho-Tyr546) rabbit pAb
ES14991-02 100 µL

M-CSF Receptor (phospho-Tyr546) rabbit pAb

Sign In for Pricing
View Details