What is the catalog number for Rgs7 Antibody - N-terminal region?

The catalog number for Rgs7 Antibody - N-terminal region is ARP42839_T100-25UL.

What sizes are available for Rgs7 Antibody - N-terminal region?

Rgs7 Antibody - N-terminal region is available in the following size(s): 25 µL.

Is Rgs7 Antibody - N-terminal region in stock?

Rgs7 Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Is there an additional fee for hazardous or dry ice shipping of this product?

Yes, if this product requires dry ice or is classed as hazardous for transport, the additional fee will be explicitly shown in your quotation before you confirm the order, so there are no surprise charges later.

How many freeze-thaw cycles can this product tolerate?

We recommend aliquoting the product upon receipt to avoid repeated freeze-thaw cycles, which can reduce activity and stability. This is your responsibility once the product has been delivered.

Is antigen retrieval required for IHC with this antibody?

Recommended antigen retrieval methods, where applicable, are listed on the datasheet under the IHC protocol section.

Rgs7 Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

Regulator of G protein signaling 7

Gene ID

24012

Swiss Prot

P49802-2

Accession Number

NP_036010

Reactivity

Human, Mouse, Rat, Cow

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of mouse Rgs7

Target

Rgs7 inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits thereby driving them into their inactive GDP-bound form. Activity on G (o) -alpha is specifically enhanced by the RGS6/GNG5 dimer. It may play an important role in the rapid regulation of neuronal excitability and the cellular responses to short-lived stimulations and in synaptic vesicle exocytosis

Partner Proteins

Rgs7bp

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

MAQGNNYGQTSNGVADESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFL

Applications

Purification

Protein A purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol