What is the catalog number for ATG4A Antibody - N-terminal region?

The catalog number for ATG4A Antibody - N-terminal region is ARP42689_P050-25UL.

What sizes are available for ATG4A Antibody - N-terminal region?

ATG4A Antibody - N-terminal region is available in the following size(s): 25 µL.

Is ATG4A Antibody - N-terminal region in stock?

ATG4A Antibody - N-terminal region is currently made to order / not held in immediate stock. Contact us for lead time.

Can I get a trial-size or discounted first order of this product?

We don’t generally offer free samples, but trial discounts in exchange for feedback and validation results are almost always possible. Contact us with your intended application to arrange one.

Do you offer bulk or custom quantities of this product?

Yes. Ordering two or more units, or combining this with other products, usually qualifies for a discount depending on quantity. Contact our sales team with your required volume for a custom quote.

Do you provide a Certificate of Analysis (CoA) for this product?

A Certificate of Analysis is available for most products upon request. Contact our support team with the lot number to obtain the relevant CoA.

ATG4A Antibody - N-terminal region

Product Specifications

CAS Number

9007-83-4

Gene Name

ATG4 autophagy related 4 homolog A (S. cerevisiae)

Gene Aliases

APG4A, AUTL2

Gene ID

115201

Swiss Prot

Q8WYN0

Accession Number

NP_443168

Reactivity

Human, Mouse, Rat, Cow, Dog, Horse, Pig, Rabbit, Zebrafish

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human ATG4A

Target

Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. ATG4A is a member of the autophagin protein family. ATG4A is also designated as a member of the C-54 family of cysteine proteases.Autophagy is the process by which endogenous proteins and damaged organelles are destroyed intracellularly. Autophagy is postulated to be essential for cell homeostasis and cell remodeling during differentiation, metamorphosis, non-apoptotic cell death, and aging. Reduced levels of autophagy have been described in some malignant tumors, and a role for autophagy in controlling the unregulated cell growth linked to cancer has been proposed. This gene encodes a member of the autophagin protein family. The encoded protein is also designated as a member of the C-54 family of cysteine proteases. Transcript variants that encode distinct isoforms have been identified.

Partner Proteins

CDKL3; GABARAPL1; GABARAPL2; ATG101; MAP1LC3B

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

DAGWGCMLRCGQMMLAQALICRHLGRDWSWEKQKEQPKEYQRILQCFLDR

Applications

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Cow: 100%; Dog: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Pig: 100%; Rabbit: 100%; Rat: 93%; Zebrafish: 79%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

45kDa

Protein Length

398

NCBI Gene Symbol

ATG4A

Host or Source

Rabbit

Protein Name

Cysteine protease ATG4A

Gene Name URL