Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RHCE antibody - N-terminal region (ARP42567_P050)

Product Specifications

CAS Number

9007-83-4

Gene Name

Rh blood group, CcEe antigens

Gene Aliases

RH, RHC, RHE, Rh4, RHNA, RHPI, RhVI, RH30A, RHIXB, RhVIII, CD240CE, RhIVb (J), RHCe (152N)

Gene ID

6006

Swiss Prot

P18577

Accession Number

NP_619522

Reactivity

Human

Immunogen

The immunogen is a synthetic peptide directed towards the N terminal region of human RHCE

Target

The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease.The Rh blood group system is the second most clinically significant of the blood groups, second only to ABO. It is also the most polymorphic of the blood groups, with variations due to deletions, gene conversions, and missense mutations. The Rh blood group includes this gene which encodes both the RhC and RhE antigens on a single polypeptide and a second gene which encodes the RhD protein. The classification of Rh-positive and Rh-negative individuals is determined by the presence or absence of the highly immunogenic RhD protein on the surface of erythrocytes. A mutation in this gene results in amorph-type Rh-null disease. Alternative splicing of this gene results in four transcript variants encoding four different isoforms.

Clonality

Polyclonal

Type

Polyclonal Antibody

Sequence

SSKYPRSVRRCLPLCALTLEAALILLFYFFTHYDASLEDQKGLVASYQVG

Applications

WB

Purification

Affinity Purified

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Concentration

0.5 mg/ml

Homology

Human: 100%

Format

Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Reconstitution

For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.

Molecular Weight

29kDa

Protein Length

266

NCBI Gene Symbol

RHCE

Host or Source

Rabbit

Protein Name

Blood group Rh (CE) polypeptide

Gene Name URL

RHCE

Nucleotide Accession Number

NM_138616

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFI-16 Polyclonal Antibody
JOT-AP04346-01 50ul

IFI-16 Polyclonal Antibody

Sign In for Pricing
View Details
IFI-16 Polyclonal Antibody
JOT-AP04346-02 100ul

IFI-16 Polyclonal Antibody

Sign In for Pricing
View Details
DDAH2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)
LV699099 1.0 µg DNA

DDAH2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-GFP-2A-Puro)

Sign In for Pricing
View Details
Pigment Yellow 155
MF-0121161-01 10 mg

Pigment Yellow 155

Sign In for Pricing
View Details
Pigment Yellow 155
MF-0121161-02 50 mg

Pigment Yellow 155

Sign In for Pricing
View Details
Human I-PTH (IntactParathormone) ELISA Kit
ELK2427-01 48 Tests

Human I-PTH (IntactParathormone) ELISA Kit

Sign In for Pricing
View Details